Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.63
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.2e-09
psoriasis 6694 3.0e-03

Gene RIF (1)

AA Sequence

MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPFALY             1 - 63
//

Text Mined References (7)

PMID Year Title