Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.72
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8519 3.7e-10
osteosarcoma 7950 8.7e-07
psoriasis 6694 1.6e-04
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.400 1.4e-03
osteosarcoma 1.352 8.7e-07
ovarian cancer 1.100 3.7e-10
psoriasis -1.300 1.6e-04

Gene RIF (1)

AA Sequence

MSFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPTACQPTC      1 - 70
YRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVSTV     71 - 140
CQPACGVSRTYQQSCVSSCRRTC                                                   141 - 163
//

Text Mined References (6)

PMID Year Title