Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.23
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Synonym

Accession Q8IUC1 A1L4I8
Symbols HACL1
HACL-1
KAP11.1

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20494980 The KRTAP11-1 promoter is activated by Trichostatin A (TSA) treatment and by serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

MSFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPTACQPTC      1 - 70
YRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVSTV     71 - 140
CQPACGVSRTYQQSCVSSCRRTC                                                   141 - 163
//

Text Mined References (6)

PMID Year Title
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15385554 2004 Krtap16, characterization of a new hair keratin-associated protein (KAP) gene complex on mouse chromosome 16 and evidence for regulation by Hoxc13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359730 2002 Characterization of a first domain of human high glycine-tyrosine and high sulfur keratin-associated protein (KAP) genes on chromosome 21q22.1.
10830953 2000 The DNA sequence of human chromosome 21.