Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 0.001
psoriasis -2.200 0.000

AA Sequence

MKPVLPLQFLVVFCLALQLVPGSPKQRVLKYILEPPPCISAPENCTHLCTMQEDCEKGFQCCSSFCGIVC      1 - 70
SSETFQKRNRIKHKGSEVIMPAN                                                    71 - 93
//

Text Mined References (5)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.