Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.6e-13
diabetes mellitus 1728 1.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 1.1e-03
psoriasis -2.200 5.6e-13

AA Sequence

MKPVLPLQFLVVFCLALQLVPGSPKQRVLKYILEPPPCISAPENCTHLCTMQEDCEKGFQCCSSFCGIVC      1 - 70
SSETFQKRNRIKHKGSEVIMPAN                                                    71 - 93
//

Text Mined References (5)

PMID Year Title