Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.27
PubTator Score 2.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.2e-04

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 2.2e-04

Gene RIF (1)

AA Sequence

MWTVRTEGGHFPLHSPTFSWRNVAFLLLLSLALEWTSAMLTKKIKHKPGLCPKERLTCTTELPDSCNTDF      1 - 70
DCKEYQKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDA     71 - 140
CRTACMLIVKDGQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTK    141 - 210
IDKPKCLQDEECPLVEKCCSHCGLKCMDPRR                                           211 - 241
//

Text Mined References (5)

PMID Year Title