Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.27
PubTator Score 2.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

Gene RIF (1)

PMID Text
21536719 We propose that the evolution of WFDC8 and SPINT4 has been shaped by complex selective scenarios due to the interdependence of variant fitness and ecological variables.

AA Sequence

MWTVRTEGGHFPLHSPTFSWRNVAFLLLLSLALEWTSAMLTKKIKHKPGLCPKERLTCTTELPDSCNTDF      1 - 70
DCKEYQKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDA     71 - 140
CRTACMLIVKDGQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTK    141 - 210
IDKPKCLQDEECPLVEKCCSHCGLKCMDPRR                                           211 - 241
//

Text Mined References (5)

PMID Year Title
23292442 2013 Reproduction and immunity-driven natural selection in the human WFDC locus.
21536719 2011 Differing evolutionary histories of WFDC8 (short-term balancing) in Europeans and SPINT4 (incomplete selective sweep) in Africans.
15950183 2005 The evolution of a genetic locus encoding small serine proteinase inhibitors.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.