Property Summary

NCBI Gene PubMed Count 42
PubMed Score 53.72
PubTator Score 54.34

Knowledge Summary

Patent (950)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
osteosarcoma 7950 3.9e-07
ovarian cancer 8520 1.5e-04
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 4.316 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03
osteosarcoma 1.345 3.9e-07
ovarian cancer -1.100 1.5e-04

Gene RIF (49)

AA Sequence

MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAPPLVLFLLGLV      1 - 70
MNNNVSMLAEEWKRPLGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVSALGN     71 - 140
GSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYLRCISQALGWSFVLLTTLLAFVVRSVRPCFT    141 - 210
QAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTP    211 - 280
DGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV        281 - 346
//

Text Mined References (43)

PMID Year Title