Property Summary

NCBI Gene PubMed Count 40
Grant Count 11
R01 Count 8
Funding $1,494,070.66
PubMed Score 47.00
PubTator Score 54.34

Knowledge Summary

Patent (950)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.345 0.000
diabetes mellitus 1.100 0.001
ovarian cancer -1.100 0.000

Gene RIF (48)

PMID Text
26944452 CALHM1 polymorphism may be potential biomarker in patients with Alzheimer disease. [meta-analysis]
26416646 In the presence of antibody, P86L-CALHM1 shifts the balance between neurodegeneration and neuronal survival toward the stimulation of pro-cytotoxic pathways, thus potentially contributing to its deleterious effects in Alzheimer's disease.
25386646 The rare R154H variant interferes with CALHM1 control of cytosolic Ca2+ and Abeta accumulation.
24630757 CALHM1 p.P86L variation may not be an AD susceptibility factor in the Han Chinese population.
24326043 This study showed that No association between polymorphisms in the calcium homeostasis modulator 1 gene and mesial temporal lobe epilepsy risk in a Chinese population
24069280 rare genetic variants in CALHM1 lead to Ca(2+) dysregulation and may contribute to the risk of EOAD through a mechanism independent from the classical Ass cascade.
23884934 Our data show that CLHM-1 is a functionally conserved ion channel that plays an important but potentially toxic role in excitable cell function.
23467090 CALHM1 is a voltage-gated ATP-release channel required for sweet, bitter and umami taste perception
23345406 The study identifies a previously uncharacterized mechanism of control of Ca(2+)-dependent ERK1/2 signaling in neurons, and further establishes CALHM1 as a critical ion channel for neuronal signaling and function.
23300080 Structural and functional similarities of calcium homeostasis modulator 1 (CALHM1) ion channel with connexins, pannexins, and innexins.
More...

AA Sequence

MMDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAAYSAGILLAPPLVLFLLGLV      1 - 70
MNNNVSMLAEEWKRPLGRRAKDPAVLRYMFCSMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVSALGN     71 - 140
GSLAPGLPAPELARLLARVPCPEIYDGDWLLAREVAVRYLRCISQALGWSFVLLTTLLAFVVRSVRPCFT    141 - 210
QAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTP    211 - 280
DGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV        281 - 346
//

Text Mined References (41)

PMID Year Title
26944452 2016 Calcium homeostasis modulator 1 gene P86L polymorphism and the risk for alzheimer's disease: A meta-analysis.
26416646 2015 CALHM1 and its polymorphism P86L differentially control Ca²?homeostasis, mitogen-activated protein kinase signaling, and cell vulnerability upon exposure to amyloid ?.
25386646 2014 Effect of the CALHM1 G330D and R154H human variants on the control of cytosolic Ca2+ and A? levels.
24630757 2014 Lack of association between CALHM1 p.P86L variation and Alzheimer's disease in the Han Chinese population.
24326043 2014 No association between polymorphisms in the calcium homeostasis modulator 1 gene and mesial temporal lobe epilepsy risk in a Chinese population.
24069280 2013 Rare variants in calcium homeostasis modulator 1 (CALHM1) found in early onset Alzheimer's disease patients alter calcium homeostasis.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23884934 2013 CLHM-1 is a functionally conserved and conditionally toxic Ca2+-permeable ion channel in Caenorhabditis elegans.
23467090 2013 CALHM1 ion channel mediates purinergic neurotransmission of sweet, bitter and umami tastes.
23345406 2013 CALHM1 controls the Ca²?-dependent MEK, ERK, RSK and MSK signaling cascade in neurons.
More...