Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
R01 Count 1
Funding $179,666.67
PubMed Score 9.32
PubTator Score 8.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.226 0.000
cystic fibrosis 1.500 0.005
psoriasis 1.700 0.000

Synonym

Accession Q8IU89 Q8NE64 Q8NEN6 CerS3
Symbols ARCI9
LASS3

Gene

 Grant Application (1)

Gene RIF (6)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
26045466 testis-specific SLs, which we also link to CerS3 in human testis, are quintessential for male fertility.
23898208 HIV-1 Tat upregulates the expression of ceramide synthase 3 (CERS3) in human primary T cells
23754960 these data present a novel pathway involved in ARCI development and, moreover, provide the first evidence that CERS3 plays an essential role in human sphingolipid metabolism for the maintenance of epidermal lipid homeostasis.
23549421 Our findings demonstrate that synthesis of very long chain ceramides by CerS3 is a crucial early step for the skin barrier formation and link disorders presenting with congenital ichthyosis to defects in sphingolipid metabolism and lipid architecture.
20304771 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFVASPLAKSFGI      1 - 70
KETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSRRNQERPSRLKKFQEACWRFA     71 - 140
FYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYWYYILEMSFYWSLLFRLGFDVKRKDFLAHII    141 - 210
HHLAAISLMSFSWCANYIRSGTLVMIVHDVADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFP    211 - 280
FWILYCTLILPMYHLEPFFSYIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEE    281 - 350
EEEEEATKGKEMDCLKNGLRAERHLIPNGQHGH                                         351 - 383
//

Text Mined References (12)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
26045466 2015 Male meiotic cytokinesis requires ceramide synthase 3-dependent sphingolipids with unique membrane anchors.
23754960 2013 Mutations in CERS3 cause autosomal recessive congenital ichthyosis in humans.
23549421 2013 Impaired epidermal ceramide synthesis causes autosomal recessive congenital ichthyosis and reveals the importance of ceramide acyl chain length.
22038835 2012 Loss of ceramide synthase 3 causes lethal skin barrier disruption.
20304771 2010 A meta-analysis of four genome-wide association studies of survival to age 90 years or older: the Cohorts for Heart and Aging Research in Genomic Epidemiology Consortium.
19364519 2009 Ceramide biosynthesis in keratinocyte and its role in skin function.
18308723 2008 Male germ cells require polyenoic sphingolipids with complex glycosylation for completion of meiosis: a link to ceramide synthase-3.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...