Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.48
PubTator Score 8.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.400 4.7e-03
medulloblastoma, large-cell 1.200 8.6e-05
non-small cell lung cancer 1.226 7.6e-08
psoriasis 1.700 2.4e-38

Gene RIF (6)

AA Sequence

MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFVASPLAKSFGI      1 - 70
KETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSRRNQERPSRLKKFQEACWRFA     71 - 140
FYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYWYYILEMSFYWSLLFRLGFDVKRKDFLAHII    141 - 210
HHLAAISLMSFSWCANYIRSGTLVMIVHDVADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFP    211 - 280
FWILYCTLILPMYHLEPFFSYIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEE    281 - 350
EEEEEATKGKEMDCLKNGLRAERHLIPNGQHGH                                         351 - 383
//

Text Mined References (12)

PMID Year Title