Property Summary

Ligand Count 2
NCBI Gene PubMed Count 49
PubMed Score 13.16
PubTator Score 15.45

Knowledge Summary

Patent (3,280)

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.200 3.2e-03
astrocytic glioma -1.900 2.8e-03
Astrocytoma, Pilocytic -1.600 2.0e-06
atypical teratoid / rhabdoid tumor -1.500 3.6e-04
cystic fibrosis -1.200 2.8e-04
ependymoma -1.200 9.4e-03
glioblastoma -1.800 5.3e-07
group 3 medulloblastoma -1.200 4.1e-02
interstitial lung disease 1.100 1.3e-02
intraductal papillary-mucinous adenoma (... -2.600 6.9e-04
intraductal papillary-mucinous carcinoma... -3.400 1.0e-05
intraductal papillary-mucinous neoplasm ... -2.700 8.4e-04
lung carcinoma 1.600 6.7e-16
malignant mesothelioma -1.100 2.6e-04
medulloblastoma, large-cell -1.400 8.6e-03
oligodendroglioma -1.400 2.4e-02
osteosarcoma -1.853 4.8e-04
ovarian cancer -1.500 2.1e-04
pancreatic ductal adenocarcinoma liver m... -1.497 5.6e-03
Pick disease -1.300 1.5e-02
primitive neuroectodermal tumor -1.200 1.3e-03
progressive supranuclear palsy 1.200 1.2e-02
subependymal giant cell astrocytoma -1.417 2.7e-02
ulcerative colitis -1.700 1.4e-05

 GO Component (2)

Protein-protein Interaction (10)

Gene RIF (30)

AA Sequence

MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI      1 - 70
AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI     71 - 140
VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI    141 - 210
AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA    211 - 280
GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP    281 - 350
STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK                                       351 - 385
//

Text Mined References (54)

PMID Year Title