Property Summary

NCBI Gene PubMed Count 49
PubMed Score 12.55
PubTator Score 15.45

Knowledge Summary

Patent (3,280)

TINX Plot

  Disease Sources (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
oligodendroglioma 2849 1.23337217886387E-17
lung carcinoma 2844 6.73273455513157E-16
pilocytic astrocytoma 3086 1.18242788534037E-6
glioblastoma 5572 2.26171600116977E-6
atypical teratoid / rhabdoid tumor 4369 3.95970618954645E-6
adult high grade glioma 2148 1.00183979882745E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.01997690281868E-5
ovarian cancer 8492 6.76373202113864E-5
primitive neuroectodermal tumor 3031 1.79189265756438E-4
malignant mesothelioma 3163 2.62536597148692E-4
cystic fibrosis 1670 2.80534046310364E-4
osteosarcoma 7933 4.84278815685437E-4
medulloblastoma 1524 5.81485683549718E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.92211117037544E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.35181165500776E-4
medulloblastoma, large-cell 6234 0.00176172833238132
astrocytic glioma 2241 0.00276972078041836
ependymoma 2514 0.00349027795794953
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00558993548319473
ulcerative colitis 2087 0.00873405758113706
interstitial lung disease 292 0.00937198561405678
progressive supranuclear palsy 674 0.0116278472554238
Pick disease 1893 0.0147452131152903
subependymal giant cell astrocytoma 2287 0.0166581110127827
Disease Target Count Z-score Confidence
Anorexia nervosa 59 0.0 1.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.056 1.5

Expression

Synonym

Accession Q8IU85 B0YIY0 Q9HD31
Symbols CKLiK
CaM-K1
CaMKID

Gene

PDB

2JC6  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (30)

PMID Text
25410890 identified the CAMK1D gene as a novel locus associated with blood pressure response to losartan
23840313 Substantiation of the roles of CAMK1D and CDKAL1 in gluconeogenic and glyconeogenic pathways in primary human hepatocytes.
22923468 Association to type 2 diabetes was found for rs13266634 (SLC30A8), rs7923837 (HHEX), rs10811661 (CDKN2A/2B), rs4402960 (IGF2BP2), rs12779790 (CDC123/CAMK1D), and rs2237892 (KCNQ1).
21909839 A significant association of rs10906115 in CDC123/CAMK1D and rs1359790 near SPRY2 was identified with type 2 diabetes in a Japanese population.
20927120 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20879858 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI      1 - 70
AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI     71 - 140
VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI    141 - 210
AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA    211 - 280
GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP    281 - 350
STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK                                       351 - 385
//

Text Mined References (54)

PMID Year Title
25410890 2014 Genome-wide association study identifies CAMKID variants involved in blood pressure response to losartan: the SOPHIA study.
25366777 2014 Analysis of protein-protein interaction network in chronic obstructive pulmonary disease.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25009623 2014 Investigation into the promoter DNA methylation of three genes (CAMK1D, CRY2 and CALM2) in the peripheral blood of patients with type 2 diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23840313 2013 RNAi screening in primary human hepatocytes of genes implicated in genome-wide association studies for roles in type 2 diabetes identifies roles for CAMK1D and CDKAL1, among others, in hepatic glucose regulation.
23568457 2013 Genetic variants associated with disordered eating.
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
More...