Property Summary

Ligand Count 16
NCBI Gene PubMed Count 94
PubMed Score 125.36
PubTator Score 129.08

Knowledge Summary


No data available


  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.200 8.0e-04
medulloblastoma, large-cell 1.200 3.7e-03
osteosarcoma 1.840 2.9e-06
pituitary cancer 1.300 1.7e-02
psoriasis -2.800 4.3e-93

Gene RIF (81)

AA Sequence

LSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQVVT                                 771 - 811

Text Mined References (98)

PMID Year Title