Property Summary

NCBI Gene PubMed Count 32
PubMed Score 37.36
PubTator Score 51.59

Knowledge Summary

Patent (1,494)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.0e-04
interstitial cystitis 1.700 2.1e-03
osteosarcoma -4.194 1.7e-08
primary pancreatic ductal adenocarcinoma 1.125 2.9e-02
primary Sjogren syndrome 2.200 5.0e-04
subependymal giant cell astrocytoma 1.159 2.7e-02
ulcerative colitis 1.200 1.8e-04

 GO Function (1)

Gene RIF (21)

AA Sequence

MLLPRSVSSERAPGVPEPEELWEAEMERLRGSGTPVRGLPYAMMDKRLIWQLREPAGVQTLRWQRWQRRR      1 - 70
QTVERRLREAAQRLARGLGLWEGALYEIGGLFGTGIRSYFTFLRFLLLLNLLSLLLTASFVLLPLVWLRP     71 - 140
PDPGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVGPESSSVYSIRLAYLLSPL    141 - 210
ACLLLCFCGTLRRMVKGLPQKTLLGQGYQAPLSAKVFSSWDFCIRVQEAATIKKHEISNEFKVELEEGRR    211 - 280
FQLMQQQTRAQTACRLLSYLRVNVLNGLLVVGAISAIFWATKYSQDNKEESLFLLLQYLPPGVIALVNFL    281 - 350
GPLLFTFLVQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWE    351 - 420
NSVGEELYKLSIFNFLLTVAFAFLVTLPRRLLVDRFSGRFWAWLEREEFLVPKNVLDIVAGQTVTWMGLF    421 - 490
YCPLLPLLNSVFLFLTFYIKKYTLLKNSRASSRPFRASSSTFFFQLVLLLGLLLAAVPLGYVVSSIHSSW    491 - 560
DCGLFTNYSAPWQVVPELVALGLPPIGQRALHYLGSHAFSFPLLIMLSLVLTVCVSQTQANARAIHRLRK    561 - 630
QLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSFCPGCPCPGSPGHQAPRPGPSVVDAAG    631 - 700
LRSPCPGQHGAPASARRFRFPSGAEL                                                701 - 726
//

Text Mined References (35)

PMID Year Title