Property Summary

NCBI Gene PubMed Count 30
Grant Count 20
R01 Count 8
Funding $6,590,699.52
PubMed Score 32.24
PubTator Score 51.59

Knowledge Summary

Patent (1,494)

Expression

  Differential Expression (6)

 GO Function (1)

Gene RIF (19)

PMID Text
26227733 TMC6/EVER1 and TMC8/EVER2 are known to be involved in the development of EV.
26126409 Findings suggest that SNPs in EVER2 may be involved in the development of premalignant skin lesions that harbour beta-HPV, perhaps giving rise to SCC tumours that have lost beta-HPV gene expression during progression.
25853559 A common genetic variation in TMC8 is associated with high-risk HPV infection and head and neck squamous cell carcinoma etiology.
25495765 We found a possible correlation between the EVER2 TT genotype and the development of AK, suggesting a potential role of this polymorphism in the development of AK.
25378492 Expression of both EVER1 and EVER2 in B cells is activated immediately after Epstein-Barr virus (EBV) infection, whereas at later stages, it is strongly repressed by latent membrane protein 1-activated NF-kappaB signaling.
25220380 TMC8 was found to be localized in the endoplasmic reticulum (ER), where it inhibited receptor mediated Ca(2+) release, activation of Ano1 and volume regulated LRRC8-related Cl(-) currents.
24586810 Loss of the HPV-infection resistance EVER2 protein impairs NF-kappaB signaling pathways in keratinocytes.
23535066 We report a case of Merkel cell polyomavirus detection in the skin of a patient with epidermodysplasia verruciformis (EDV) and a family history remarkable for an unusual inheritance pattern for EDV.
23534907 EV is also a rare autosomal recessive genodermatosis involving susceptibility to human papillomavirus (HPV) infections and squamous cell carcinoma, caused in most cases by homozygous mutations in EVER1 or EVER2.
23429285 Ever2 interacts with the N-terminal domain of TRADD, impairs the recruitment of TRAF2 and RIPK1 and promotes apoptosis.
More...

AA Sequence

MLLPRSVSSERAPGVPEPEELWEAEMERLRGSGTPVRGLPYAMMDKRLIWQLREPAGVQTLRWQRWQRRR      1 - 70
QTVERRLREAAQRLARGLGLWEGALYEIGGLFGTGIRSYFTFLRFLLLLNLLSLLLTASFVLLPLVWLRP     71 - 140
PDPGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVGPESSSVYSIRLAYLLSPL    141 - 210
ACLLLCFCGTLRRMVKGLPQKTLLGQGYQAPLSAKVFSSWDFCIRVQEAATIKKHEISNEFKVELEEGRR    211 - 280
FQLMQQQTRAQTACRLLSYLRVNVLNGLLVVGAISAIFWATKYSQDNKEESLFLLLQYLPPGVIALVNFL    281 - 350
GPLLFTFLVQLENYPPNTEVNLTLIWCVVLKLASLGMFSVSLGQTILCIGRDKSSCESYGYNVCDYQCWE    351 - 420
NSVGEELYKLSIFNFLLTVAFAFLVTLPRRLLVDRFSGRFWAWLEREEFLVPKNVLDIVAGQTVTWMGLF    421 - 490
YCPLLPLLNSVFLFLTFYIKKYTLLKNSRASSRPFRASSSTFFFQLVLLLGLLLAAVPLGYVVSSIHSSW    491 - 560
DCGLFTNYSAPWQVVPELVALGLPPIGQRALHYLGSHAFSFPLLIMLSLVLTVCVSQTQANARAIHRLRK    561 - 630
QLVWQVQEKWHLVEDLSRLLPEPGPSDSPGPKYPASQASRPQSFCPGCPCPGSPGHQAPRPGPSVVDAAG    631 - 700
LRSPCPGQHGAPASARRFRFPSGAEL                                                701 - 726
//

Text Mined References (33)

PMID Year Title
26227733 2015 Risk of Cutaneous Squamous Cell Carcinoma Development in Renal Transplant Recipients Is Independent of TMC/EVER Alterations.
26126409 2015 Genetic variations in the epidermodysplasia verruciformis (EVER/TMC) genes, cutaneous human papillomavirus infection and squamous cell carcinoma of the skin.
25853559 2015 A coding variant in TMC8 (EVER2) is associated with high risk HPV infection and head and neck cancer risk.
25495765 2015 Possible association between actinic keratosis and the rs7208422 (c.917A?T, p.N306l) polymorphism of the EVER2 gene in patients without epidermodysplasia verruciformis.
25378492 2015 Expression of the epidermodysplasia verruciformis-associated genes EVER1 and EVER2 is activated by exogenous DNA and inhibited by LMP1 oncoprotein from Epstein-Barr virus.
25220380 2014 TMC8 (EVER2) attenuates intracellular signaling by Zn2+ and Ca2+ and suppresses activation of Cl- currents.
24586810 2014 Loss of the HPV-infection resistance EVER2 protein impairs NF-?B signaling pathways in keratinocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535066 Merkel cell polyomavirus detection in a patient with familial epidermodysplasia verruciformis.
23534907 Epidermodysplasia verruciformis in lipoid proteinosis: case report and discussion of pathophysiology.
More...