Property Summary

NCBI Gene PubMed Count 31
Grant Count 6
R01 Count 4
Funding $346,862.28
PubMed Score 33.11
PubTator Score 34.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 2.093 0.000
posterior fossa group B ependymoma 2.000 0.000
adult high grade glioma 1.100 0.016
pilocytic astrocytoma 1.200 0.006
Breast cancer -1.300 0.000
facioscapulohumeral dystrophy 1.600 0.023

Gene RIF (24)

PMID Text
27166550 Selective expression of IFNlambdaR1 was considered to be a plus point towards the targeted anti-viral activity of IFNlambdas but artificial control on its expression will surely make IFNlambdas a better drug with enhanced activity.
26400298 Polymorphism within the IL-28R1, but not in IL-28B, is associated with benign prostatic hyperplasia and lower urinary tract symptoms in Chinese.
25911176 expression of IL-28RA mRNA may be correlated with the pathogenesis of systemic lupus erythematosus
24752298 IFN-lambda receptor 1 expression is induced in chronic hepatitis C and correlates with the IFN-lambda3 genotype and with nonresponsiveness to IFN-alpha therapies.
24510368 This study is the first to show the activation of a type III interferon response in low-risk human papillomavirus positive cervical cells and suggests that the lack of this response may be related to lesion progression.
24438680 IL28RA polymorphism (rs10903035) seems to be implicated in the glucose homeostasis because AA genotype increases the likelihood of IR, but this association was different depending on hepatic fibrosis and HCV genotype.
24409098 Epigenetic reprogramming of IFNLR1-mediated response potentiates antiviral activity and suppresses tumor growth.
24144988 Results show that the distribution of IL10RB and IL28RA genotypes among the Hepatitis C virus-infected and control groups did not differ significantly.
23565619 The rs12980275 AG/GG genotype and rs10903035 G allele remained independently associated with early pegylated interferon and ribavirin failure of hepatitis C in hepatitis C/HIV coinfected patients.
22891284 Plasmacytoid dendritic cells are major producers of IFN-lambda2 (a type III interferon) in response to viral stimulation and also express functional receptors for this cytokine.
More...

AA Sequence

MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWRE      1 - 70
VEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILS     71 - 140
ANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYS    141 - 210
KFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQ    211 - 280
PSRPESVNDLFLCPQKELTRGVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFL    281 - 350
GQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDG    351 - 420
HQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEEEEEARESE    421 - 490
IEDSDAGSWGAESTQRTEDRGRTLGHYMAR                                            491 - 520
//

Text Mined References (33)

PMID Year Title
27166550 2016 Unraveling the molecular mechanism governing the tissue specific expression of IFN?R1.
26400298 2015 Association of polymorphism within the interleukin-28 receptor alpha gene, but not in interleukin-28B, with lower urinary tract symptoms (LUTS) in Chinese.
25911176 2015 Increased expression of IL-28RA mRNA in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
24752298 2014 IFN-? receptor 1 expression is induced in chronic hepatitis C and correlates with the IFN-?3 genotype and with nonresponsiveness to IFN-? therapies.
24510368 2014 Interferon lambda 1 expression in cervical cells differs between low-risk and high-risk human papillomavirus-positive women.
24438680 2014 IL28RA polymorphism (rs10903035) is associated with insulin resistance in HIV/HCV-coinfected patients.
24409098 2014 Epigenetic reprogramming of the type III interferon response potentiates antiviral activity and suppresses tumor growth.
24144988 2014 Evaluation of the relationship between IL28B, IL10RB and IL28RA single-nucleotide polymorphisms and susceptibility to hepatitis C virus in Chinese Han population.
23565619 2013 IL28RA polymorphism is associated with early hepatitis C virus (HCV) treatment failure in human immunodeficiency virus-/HCV-coinfected patients.
22891284 2012 Type III IFNs are produced by and stimulate human plasmacytoid dendritic cells.
More...