Property Summary

NCBI Gene PubMed Count 33
PubMed Score 40.35
PubTator Score 34.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 2.3e-09
ependymoma 4679 3.4e-09
osteosarcoma 7950 1.6e-08
Astrocytoma, Pilocytic 3081 5.4e-03
adult high grade glioma 3801 1.6e-02
facioscapulohumeral dystrophy 288 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
psoriasis 6694 0.0 2.9

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 1.6e-02
Astrocytoma, Pilocytic 1.200 5.4e-03
Breast cancer -1.300 2.3e-09
ependymoma 1.900 3.4e-09
facioscapulohumeral dystrophy 1.600 2.3e-02
osteosarcoma 2.093 1.6e-08

Gene RIF (26)

AA Sequence

MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWRE      1 - 70
VEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILS     71 - 140
ANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYS    141 - 210
KFSKPTCFLLEVPEANWAFLVLPSLLILLLVIAAGGVIWKTLMGNPWFQRAKMPRALDFSGHTHPVATFQ    211 - 280
PSRPESVNDLFLCPQKELTRGVRPTPRVRAPATQQTRWKKDLAEDEEEEDEEDTEDGVSFQPYIEPPSFL    281 - 350
GQEHQAPGHSEAGGVDSGRPRAPLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPGGDG    351 - 420
HQESLPPPEFSKDSGFLEELPEDNLSSWATWGTLPPEPNLVPGGPPVSLQTLTFCWESSPEEEEEARESE    421 - 490
IEDSDAGSWGAESTQRTEDRGRTLGHYMAR                                            491 - 520
//

Text Mined References (35)

PMID Year Title