Property Summary

NCBI Gene PubMed Count 85
Grant Count 25
R01 Count 4
Funding $1,821,910.47
PubMed Score 86.44
PubTator Score 28.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hepatitis C 90 3.522 1.8
Hepatitis 61 3.225 1.6

Gene RIF (78)

PMID Text
26896692 showed that silencing IFN-lambda1 in T/T cell line reduced basal IFN-stimulated gene expression and improved antiviral activity
26718740 activation of TLR7 upregulated the expression levels of IFN-lambda1 and MMP-9 were increased by ~3 fold, whereas other genes (p53, PTEN, TIMP-1) were upregulated by ~2 fold, and VEGF was marginally upregulated after 10 min.
26420479 IL-29 directly induces RANKL expression in rheumatoid arthritis-fibroblasts like synoviocytes via MAPK signaling pathway.
26353965 NS of severe fever with thrombocytopenia syndrome virus inhibited the activity of IFN-alpha1, IFN-beta, IFN-lambda1 and IFN-lambda2 through inhibition of STAT1 phosphorylation.
26336095 Data suggest that naturally occurring iDVGs (immunostimulatory defective viral genomes) trigger robust host antiviral/innate immunity responses including/requiring up-regulation of IFNL1 and IFNB1 (interferon beta 1) in respiratory mucosa.
26278073 IL-29 can aggravate LPS/TLR4-mediated inflammation.
26194286 Studies indicate that the type III interferons (IFNs) or IFN-lambdas consists of four members: IFN-lambda1 (IL-29), IFN-lambda2 (IL28A), IFN-lambda3 (IL-28B) and IFN-lambda4.
26057401 IFN-lambda-1 and interferon-gamma levels in systemic sclerosis patients were significantly higher than those in healthy individuals.
25936570 this study failed to prove any significant association between polymorphisms in IL29 gene rs30461 or IL10 gene (-1082, -819 and -592) or cytokine haplotype and either response to therapy or severity of HCV infection in children.
25784275 Severity of rhinovirus-induced asthma symptoms is inversely related to resolution IFNL1 expression.
More...

AA Sequence

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSS      1 - 70
PVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGP     71 - 140
RPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST              141 - 200
//

Text Mined References (88)

PMID Year Title
26896692 2016 Cellular Mechanism for Impaired Hepatitis C Virus Clearance by Interferon Associated with IFNL3 Gene Polymorphisms Relates to Intrahepatic Interferon-? Expression.
26718740 2016 Activation of Toll-like receptor 7 regulates the expression of IFN-?1, p53, PTEN, VEGF, TIMP-1 and MMP-9 in pancreatic cancer cells.
26420479 2015 Interleukin-29 induces receptor activator of NF-?B ligand expression in fibroblast-like synoviocytes via MAPK signaling pathways.
26353965 2015 Suppression of type I and type III IFN signalling by NSs protein of severe fever with thrombocytopenia syndrome virus through inhibition of STAT1 phosphorylation and activation.
26336095 2015 Immunostimulatory Defective Viral Genomes from Respiratory Syncytial Virus Promote a Strong Innate Antiviral Response during Infection in Mice and Humans.
26278073 2015 IL-29 Enhances LPS/TLR4-Mediated Inflammation in Rheumatoid Arthritis.
26194286 2015 Guarding the frontiers: the biology of type III interferons.
26057401 2015 Interferons and systemic sclerosis: correlation between interferon gamma and interferon-lambda 1 (IL-29).
25936570 2015 Potential genetic markers for prediction of treatment response in Egyptian children infected with HCV genotype 4.
25784275 2015 Severity of virus-induced asthma symptoms is inversely related to resolution IFN-? expression.
More...