Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

 Compartment GO Term (0)

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MAGTRGLMLLGPGPVAGPRDVGTCRGRQMEIQKHKDNKKLPQGIIIVFRLQTHTTPQIYTQLKGKLRKFF      1 - 70
KEPYSE                                                                     71 - 76
//

Text Mined References (15)

PMID Year Title