Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.56
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.4e-20

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 1.4e-20

Synonym

Accession Q86Z23
Symbols CTRP11
C1QTNF11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVLLLLVAIPLLVHSSRGPAHYEMLGRCRMVCDPHGPRGPGPDGAPASVPPFPPGAKGEVGRRGKAGLRG      1 - 70
PPGPPGPRGPPGEPGRPGPPGPPGPGPGGVAPAAGYVPRIAFYAGLRRPHEGYEVLRFDDVVTNVGNAYE     71 - 140
AASGKFTCPMPGVYFFAYHVLMRGGDGTSMWADLMKNGQVRASAIAQDADQNYDYASNSVILHLDVGDEV    141 - 210
FIKLDGGKVHGGNTNKYSTFSGFIIYPD                                              211 - 238
//

Text Mined References (3)

PMID Year Title