Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
R01 Count 5
Funding $746,573.33
PubMed Score 4.93
PubTator Score 11.18

Knowledge Summary

Patent (2,529)

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.000
astrocytic glioma 1.700 0.034
ependymoma 1.900 0.042
oligodendroglioma 1.200 0.038
psoriasis -1.900 0.000
osteosarcoma 3.195 0.000
atypical teratoid / rhabdoid tumor 1.800 0.001
glioblastoma 1.900 0.001
group 4 medulloblastoma 1.700 0.018
medulloblastoma, large-cell 1.900 0.000
Amyotrophic Lateral Sclerosis 1.236 0.000
acute quadriplegic myopathy 1.280 0.000
lung cancer -1.400 0.001
pediatric high grade glioma 1.200 0.026
subependymal giant cell astrocytoma -1.604 0.044
Alzheimer's disease 1.400 0.017
Pick disease 2.500 0.000
ovarian cancer -1.200 0.002
cystic fibrosis and chronic rhinosinusit... -1.083 0.044

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

PMID Text
25630557 Analysis of these mutants revealed that HIPK1, HIPK2 and HIPK3 but not HIPK4 are capable of autophosphorylating on other tyrosines
24559171 PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1.
23676219 HIPK1 drives p53 activation to limit colorectal cancer cell growth.
23565059 HIPK1 and HIPK2, are transcriptional corepressors that regulate TGF-beta-dependent angiogenesis during embryonic development.
23071292 HIPK1 expression was identified only in invasive breast cancer cells with three different patterns: cytoplasmic, nuclear, and both cytoplasmic and nuclear.
22173032 These findings indicate that the control of HIPK1 stability by Mdm2-NORE1 has a major effect on cell behaviour, and epigenetic inactivation of NORE1 enables adenocarcinoma formation in vivo through HIPK1 stabilization.
19646965 c-Myb appears to be phosphorylated by HIPK1 in its negative regulatory domain as supported by both in vivo and in vitro data.
15701637 TNFalpha-induced desumoylation and cytoplasmic translocation of HIPK1 are critical in TNFalpha-induced ASK1-JNK/p38 activation

AA Sequence

MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSHQVANFNIPAY      1 - 70
DQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQIIE     71 - 140
EHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKR    141 - 210
STKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLK    211 - 280
QNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCS    281 - 350
TYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT    351 - 420
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRRE    421 - 490
YIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFT    491 - 560
THVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQ    561 - 630
GVSLQPGTTQICTQTDPFQQTFIVCPPAFQTGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLT    631 - 700
QGSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVAL    701 - 770
HNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS    771 - 840
LPSKKNKQSAPVSSKSSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRS    841 - 910
DTDEEEDNKYKPSSSGLKPRSNVISYVTVNDSPDSDSSLSSPYSTDTLSALRGNSGSVLEGPGRVVADGT    911 - 980
GTRTIIVPPLKTQLGDCTVATQASGLLSNKTKPVASVSGQSSGCCITPTGYRAQRGGTSAAQPLNLSQNQ    981 - 1050
QSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHSTGHPHLAPAPAHLPSQAHLYTYAAPTSA   1051 - 1120
AALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRG   1121 - 1190
STIYTGYPLSPTKISQYSYL                                                     1191 - 1210
//

Text Mined References (32)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25630557 2015 Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK).
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24559171 2014 Cancer/testis antigen PAGE4, a regulator of c-Jun transactivation, is phosphorylated by homeodomain-interacting protein kinase 1, a component of the stress-response pathway.
23676219 2013 HIPK1 drives p53 activation to limit colorectal cancer cell growth.
23565059 2013 Transcriptional corepressors HIPK1 and HIPK2 control angiogenesis via TGF-?-TAK1-dependent mechanism.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071292 2012 Homeodomain-interacting protein kinase 1 (HIPK1) expression in breast cancer tissues.
More...