Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5.10
PubTator Score 11.18

Knowledge Summary

Patent (2,529)

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.280 1.3e-06
Alzheimer's disease 1.400 1.7e-02
Amyotrophic lateral sclerosis 1.236 3.4e-08
astrocytic glioma 1.300 9.4e-03
atypical teratoid / rhabdoid tumor 1.800 6.6e-04
cystic fibrosis and chronic rhinosinusit... -1.083 4.4e-02
ependymoma 1.800 1.1e-02
glioblastoma 1.900 9.5e-04
group 4 medulloblastoma 1.700 1.8e-02
lung cancer -1.400 5.4e-04
medulloblastoma, large-cell 1.900 4.1e-04
oligodendroglioma 1.200 3.8e-02
osteosarcoma 2.764 2.0e-07
ovarian cancer -1.200 1.5e-03
pediatric high grade glioma 1.200 2.6e-02
Pick disease 2.100 3.9e-06
psoriasis -1.900 8.7e-05
Rheumatoid arthritis 1.800 4.8e-04
subependymal giant cell astrocytoma -1.604 4.4e-02

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSHQVANFNIPAY      1 - 70
DQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQIIE     71 - 140
EHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKR    141 - 210
STKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLK    211 - 280
QNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCS    281 - 350
TYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT    351 - 420
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRRE    421 - 490
YIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFT    491 - 560
THVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQ    561 - 630
GVSLQPGTTQICTQTDPFQQTFIVCPPAFQTGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLT    631 - 700
QGSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVAL    701 - 770
HNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS    771 - 840
LPSKKNKQSAPVSSKSSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRS    841 - 910
DTDEEEDNKYKPSSSGLKPRSNVISYVTVNDSPDSDSSLSSPYSTDTLSALRGNSGSVLEGPGRVVADGT    911 - 980
GTRTIIVPPLKTQLGDCTVATQASGLLSNKTKPVASVSGQSSGCCITPTGYRAQRGGTSAAQPLNLSQNQ    981 - 1050
QSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHSTGHPHLAPAPAHLPSQAHLYTYAAPTSA   1051 - 1120
AALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRG   1121 - 1190
STIYTGYPLSPTKISQYSYL                                                     1191 - 1210
//

Text Mined References (33)

PMID Year Title