Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.81
PubTator Score 11.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
psoriasis 6694 4.2e-72
pancreatic cancer 2398 1.9e-04
pancreatic carcinoma 562 1.9e-04
gastric cancer 459 3.8e-03
osteosarcoma 7950 9.0e-03
mucosa-associated lymphoid tissue lymphoma 484 2.1e-02

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.200 3.8e-03
mucosa-associated lymphoid tissue lympho... 2.122 2.1e-02
osteosarcoma -1.513 9.0e-03
pancreatic cancer 1.800 1.9e-04
pancreatic carcinoma 1.800 1.9e-04
psoriasis 2.500 4.2e-72

Gene RIF (13)

AA Sequence

MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR      1 - 70
APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN     71 - 140
AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS    141 - 210
SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT    211 - 280
YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS                                           281 - 311
//

Text Mined References (22)

PMID Year Title