Property Summary

NCBI Gene PubMed Count 19
Grant Count 17
R01 Count 8
Funding $1,421,340.22
PubMed Score 14.31
PubTator Score 11.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
gastric cancer 1.200 0.004
pancreatic cancer 1.800 0.000
osteosarcoma -1.513 0.009
pancreatic carcinoma 1.800 0.000
mucosa-associated lymphoid tissue lympho... 2.122 0.021
psoriasis 2.500 0.000

Gene RIF (12)

PMID Text
25147325 Levels of sTLT-1 in plasma from patients with potential acute coronary syndrome were compared with an age-matched control group with similar risk factors for cardiovascular disease.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of triggering receptor expressed on myeloid cells-like 1 (TREML1) expression as compared to untreated control
22551551 Platelet-derived soluble TLT-1 is a potent endogenous regulator of sepsis-associated inflammation.
22283904 Serum sTREM-1 level measurements may be helpful in diagnosing and predicting outcome for non-tuberculous mycobacterial lung disease.
20093931 These results suggest that during inflammation, sTLT-1 may mediate hemostasis by enhancing actin polymerization, resulting in increased platelet aggregation and adherence to the endothelium.
19436112 TLT-1 plays a protective role during inflammation by dampening the inflammatory response and facilitating platelet aggregation at sites of vascular injury
19230638 antibody against the extracellular domain inhibits platelet aggregation in vitro
18612537 Phenotypic heterogeneity in the Gray platelet syndrome extends to the expression of TREM family member, TLT-1.
17549298 Define a platelet specific function for TLT1 in regulation of aggregation.
16505478 A soluble fragment of the TLT-1 extracellular domain is found in serum of humans and mice and that an isoform of similar mass is released from platelets following activation with thrombin.
More...

AA Sequence

MGLTLLLLLLLGLEGQGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRR      1 - 70
APAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAEN     71 - 140
AFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVMAKRKQGNRLGVCGRFLSSRVSGMNPS    141 - 210
SVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVT    211 - 280
YATVIFPGGNKGGGTSCGPAQNPPNNQTPSS                                           281 - 311
//

Text Mined References (21)

PMID Year Title
25147325 2015 Levels of soluble TREM-like transcript 1 in patients presenting to the emergency department with chest pain.
22551551 2012 Soluble TREM-like transcript-1 regulates leukocyte activation and controls microbial sepsis.
22283904 2011 Use of soluble triggering receptor expressed on myeloid cells-1 in non-tuberculous mycobacterial lung disease.
21813449 2011 Proteomic analysis of palmitoylated platelet proteins.
20093931 2010 Soluble TLT-1 modulates platelet-endothelial cell interactions and actin polymerization.
19436112 2009 TREM-like transcript-1 protects against inflammation-associated hemorrhage by facilitating platelet aggregation in mice and humans.
19230638 2009 TREM and TREM-like receptors in inflammation and disease.
18612537 2008 Phenotypic heterogeneity in the Gray platelet syndrome extends to the expression of TREM family member, TLT-1.
17549298 2007 Inhibition of thrombin-induced platelet aggregation using human single-chain Fv antibodies specific for TREM-like transcript-1.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...