Property Summary

NCBI Gene PubMed Count 31
Grant Count 16
R01 Count 3
Funding $7,079,161.27
PubMed Score 123.00
PubTator Score 52.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (25)

PMID Text
26174123 Phospholipase C-zeta deficiency is associated with repetitive oocyte fertilization failure during ovarian stimulation for in vitro fertilization.
26116451 Human PLCzeta elicited the characteristic Ca(2+) oscillations present at mammalian fertilization, which produced oocyte activation and embryo development.
26054556 Study further supports the fundamental role of PLCzeta in the oocyte activation process.
26009178 I discuss the recent advances in our knowledge of the intriguing biochemical and physiological properties of sperm PLCz and postulate potential roles for PLCz in terms of clinical diagnosis and therapy for certain forms of male infertility
25722320 Data suggest that PAWP (WW domain-binding protein 2-like) from sperm (rather than PLCZ [phospholipase C zeta] from sperm) acts as the 'sperm factor' within the egg at fertilization and is involved in 'egg activation' and embryogenesis. [REVIEW]
24756570 in patients with normal SA parameters but with repeated low fertilization or outright failed fertilization results after ICSI, abnormal PLCZ1 function should be considered as the underlying mechanism responsible for the failure of fertilization
24478462 Human PLCzeta exhibits superior fertilization potency over mouse PLCzeta in triggering the Ca(2+) oscillations required for mammalian oocyte activation.
24157362 PLCzeta may be a significant factor in human fertility with potential therapeutic capacity. [Review]
23916605 Male infertility is associated with the aberrant expression, localisation, structure and function of PLCzeta in human sperm. [review]
22940771 investigation of expression level and localization pattern of PLCZ1 in sperm from three infertile patients with globozoospermia (i.e., patients who exhibited abnormal sperm with round heads) [CASE REPORT]
More...

AA Sequence

MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKDNDRLKQGRITIEEFRAIYRIITHR      1 - 70
EEIIEIFNTYSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPIEEVRKAHQMSLEGFTRYMDS     71 - 140
RECLLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLLGPSDLWGYVSALVKGCRCLEIDCWDGAQNE    141 - 210
PVVYHGYTLTSKLLFKTVIQAIHKYAFMTSDYPVVLSLENHCSTAQQEVMADNLQATFGESLLSDMLDDF    211 - 280
PDTLPSPEALKFKILVKNKKIGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKLKIALALS    281 - 350
DLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNP    351 - 420
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLIS    421 - 490
GIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQG    491 - 560
LIAGNEFLGQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR                          561 - 608
//

Text Mined References (33)

PMID Year Title
26174123 2015 Phospholipase C-zeta deficiency as a cause for repetitive oocyte fertilization failure during ovarian stimulation for in vitro fertilization with ICSI: a case report.
26116451 2015 Functional disparity between human PAWP and PLC? in the generation of Ca2+ oscillations for oocyte activation.
26054556 2015 Total levels, localization patterns, and proportions of sperm exhibiting phospholipase C zeta are significantly correlated with fertilization rates after intracytoplasmic sperm injection.
26009178 2015 Novel signalling mechanism and clinical applications of sperm-specific PLC?.
25722320 2015 PLC? or PAWP: revisiting the putative mammalian sperm factor that triggers egg activation and embryogenesis.
24756570 2014 Protein phospholipase C Zeta1 expression in patients with failed ICSI but with normal sperm parameters.
24478462 2014 Human PLC? exhibits superior fertilization potency over mouse PLC? in triggering the Ca(2+) oscillations required for mammalian oocyte activation.
24157362 2013 Sperm PLC?: from structure to Ca2+ oscillations, egg activation and therapeutic potential.
23916605 2013 Phospholipase C zeta (PLC?): oocyte activation and clinical links to male factor infertility.
22940771 2012 Motile sperm organelle morphology evaluation-selected globozoospermic human sperm with an acrosomal bud exhibits novel patterns and higher levels of phospholipase C zeta.
More...