Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.48
PubTator Score 0.83

Knowledge Summary

Patent (293)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 2.09634426732678E-16
glioblastoma 5572 1.39710671593728E-5
osteosarcoma 7933 7.48177233283265E-4
primitive neuroectodermal tumor 3031 0.00149067883287947

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.822 0.001
glioblastoma -1.100 0.000
primitive neuroectodermal tumor -1.200 0.001
Breast cancer -1.200 0.000

Synonym

Accession Q86YV6 A2RUC0 Q5TAW2
Symbols SgK085

Gene

PDB

2X4F  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12471243 First identification, named SgK085 and classified as one of four myosin light chain kinases in a comprehensive analysis of protein kinases encoded by the human genome.

AA Sequence

MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSNADLTERMPVK      1 - 70
SKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTR     71 - 140
GMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFMKQ    141 - 210
ICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFV    211 - 280
SFPTDMWSVGVIAYMLLSGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRI    281 - 350
SASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK                                    351 - 388
//

Text Mined References (9)

PMID Year Title
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.