Property Summary

Ligand Count 3
NCBI Gene PubMed Count 8
PubMed Score 1.48
PubTator Score 0.83

Knowledge Summary

Patent (293)

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.200 2.1e-16
glioblastoma -1.100 1.4e-05
osteosarcoma -1.822 7.5e-04
primitive neuroectodermal tumor -1.200 1.5e-03

Protein-protein Interaction (5)

Gene RIF (2)

AA Sequence

MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSNADLTERMPVK      1 - 70
SKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTR     71 - 140
GMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFMKQ    141 - 210
ICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFV    211 - 280
SFPTDMWSVGVIAYMLLSGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRI    281 - 350
SASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK                                    351 - 388
//

Text Mined References (10)

PMID Year Title