Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $665,794.8
PubMed Score 1.48
PubTator Score 0.83

Knowledge Summary

Patent (293)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.822 0.001
glioblastoma -1.100 0.000
primitive neuroectodermal tumor -1.200 0.001
Breast cancer -1.200 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12471243 First identification, named SgK085 and classified as one of four myosin light chain kinases in a comprehensive analysis of protein kinases encoded by the human genome.

AA Sequence

MLKVKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSGHNEAKEVWSNADLTERMPVK      1 - 70
SKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTEILGGGRFGQVHKCEETATGLKLAAKIIKTR     71 - 140
GMKDKEEVKNEISVMNQLDHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFMKQ    141 - 210
ICEGIRHMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFV    211 - 280
SFPTDMWSVGVIAYMLLSGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRI    281 - 350
SASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFVTK                                    351 - 388
//

Text Mined References (9)

PMID Year Title
24124408 2013 Genome-wide association study of orthostatic hypotension and supine-standing blood pressure changes in two korean populations.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.