Property Summary

NCBI Gene PubMed Count 11
PubMed Score 46.96
PubTator Score 11.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 8.5e-33
non-small cell lung cancer 2890 1.5e-28
tuberculosis 2010 2.3e-06
osteosarcoma 7950 6.5e-06
lung adenocarcinoma 2716 1.5e-04
interstitial cystitis 2312 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis 1.700 1.8e-03
lung adenocarcinoma -1.300 1.5e-04
lung carcinoma -3.500 8.5e-33
non-small cell lung cancer -2.306 1.5e-28
osteosarcoma -4.119 6.5e-06
tuberculosis 1.800 2.3e-06

Gene RIF (3)

AA Sequence

MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYV      1 - 70
LYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLHVLPEEP     71 - 140
KELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVG    141 - 210
DIFRNDGSIMLQGVRESDGGNYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVG    211 - 280
IVCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEE    281 - 350
EEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF                              351 - 394
//

Text Mined References (13)

PMID Year Title