Property Summary

NCBI Gene PubMed Count 11
PubMed Score 42.34
PubTator Score 11.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 8.52707314565084E-33
non-small cell lung cancer 2798 1.53878981065679E-28
tuberculosis 1563 2.34939979510958E-6
osteosarcoma 7933 6.51829255972085E-6
lung adenocarcinoma 2714 1.52866594617364E-4
interstitial cystitis 2299 0.0017571042933417

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -4.119 0.000
tuberculosis 1.800 0.000
non-small cell lung cancer -2.306 0.000
interstitial cystitis 1.700 0.002
lung adenocarcinoma -1.300 0.000
lung carcinoma -3.500 0.000

Synonym

Accession Q86YT9 B0YIV1 B0YIV2 Q496M1 Q5DTC6 Q7Z499 Q8N9I7 Q8NF70
Symbols AMICA
Gm638
AMICA1
CREA7-1
CREA7-4

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064666 Integrin activation is required for the dissociation of JAM-L-VLA-4 complexes and the accumulation of functional JAM-L dimers, which indicates that the leukocyte integrin VLA-4 controls JAM-L function in cis by controlling its dimerization state.
12869515 expressed on leukocytes with a possible role in leukocyte transmigration

AA Sequence

MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYV      1 - 70
LYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLHVLPEEP     71 - 140
KELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVG    141 - 210
DIFRNDGSIMLQGVRESDGGNYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVG    211 - 280
IVCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEE    281 - 350
EEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF                              351 - 394
//

Text Mined References (13)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19064666 2008 JAM-L-mediated leukocyte adhesion to endothelial cells is regulated in cis by alpha4beta1 integrin activation.
18948633 2009 Role of junctional adhesion molecule-like protein in mediating monocyte transendothelial migration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15800062 2005 Neutrophil migration across tight junctions is mediated by adhesive interactions between epithelial coxsackie and adenovirus receptor and a junctional adhesion molecule-like protein on neutrophils.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...