Property Summary

NCBI Gene PubMed Count 30
Grant Count 29
R01 Count 15
Funding $2,265,816.4
PubMed Score 12.88
PubTator Score 2268.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
26204652 Expression of MIB1 ligase protein, human was correlated with tumor grade and Figo stages.
25795303 these results identify the interaction between Mib1 and Plk4 as a new and important element in the control of centriole homeostasis.
25747658 Data show how E3 ubiquitin protein ligase Mind bomb protein recognizes notch receptor ligands.
25319982 a significant survival benefit for p16-positive vaginal cancers compared with p16-negative cancers for stages I and II. No difference was observed in survival for MIB-1-positive tumors
25077370 This is the first published study ever assessing the expression of COX-2, p16 and Ki67 markers in ductal carcinoma in situ breast tumors.
24008756 Invasive adenomas have a higher inducible nitric oxide synthase, and this correlated with the MIB-1
23615451 Data show that the E3 ubiquitin ligase, mind bomb 1 (Mib1), interacts with and ubiquitinates SMN and facilitates its degradation.
23442362 MIB-1 was found to be associated with estrogen receptors in the stromal component
23314057 implicate NOTCH signaling in left ventricular noncompaction and indicate that MIB1 mutations arrest chamber myocardium development, preventing trabecular maturation and compaction
22184009 MIB1 negatively regulates TNFalpha- and IL1beta-induced NF-kappaB target gene activation
More...

AA Sequence

MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRI      1 - 70
LDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESR     71 - 140
RKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFE    141 - 210
GMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLT    211 - 280
TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKL    281 - 350
LQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK    351 - 420
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDV    421 - 490
EAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQD    491 - 560
SEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKD    561 - 630
DGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGD    631 - 700
TPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRN    701 - 770
KKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC    771 - 840
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPF    841 - 910
IMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHG    911 - 980
TCQLCGDRMSECPICRKAIERRILLY                                                981 - 1006
//

Text Mined References (34)

PMID Year Title
26204652 THE PROGNOSTIC SIGNIFICANCE OF P53, BCL2 AND MIB1 EXPRESSIONS RELATED WITH OTHER CLINICOPATHOLOGICAL VARIABLES IN SEROUS OVARIAN CARCINOMAS. A CLINICOPATHOLOGICAL STUDY IN PERITONEAL FLUIDS.
25795303 2015 The E3 ubiquitin ligase Mib1 regulates Plk4 and centriole biogenesis.
25747658 2015 A tail of two sites: a bipartite mechanism for recognition of notch ligands by mind bomb E3 ligases.
25319982 2014 Improved survival in p16-positive vaginal cancers across all tumor stages but no correlation with MIB-1.
25077370 2014 COX-2, p16 and Ki67 expression in DCIS, microinvasive and early invasive breast carcinoma with extensive intraductal component.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121310 2013 A new cellular stress response that triggers centriolar satellite reorganization and ciliogenesis.
24008756 2014 The clinical and pathological significance of nitric oxide synthase in human pituitary adenomas: a comparison with MIB-1.
23615451 2013 The E3 ubiquitin ligase mind bomb 1 ubiquitinates and promotes the degradation of survival of motor neuron protein.
23478405 2013 The ubiquitin ligase Mindbomb 1 coordinates gastrointestinal secretory cell maturation.
More...