Property Summary

NCBI Gene PubMed Count 34
PubMed Score 13.85
PubTator Score 2268.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.242 2.1e-02
acute myeloid leukemia -2.200 3.9e-02
acute quadriplegic myopathy 1.787 1.9e-06
Amyotrophic lateral sclerosis 1.293 8.1e-06
atypical teratoid / rhabdoid tumor -1.200 1.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.077 6.1e-03
diabetes mellitus -1.300 3.4e-03
ependymoma 1.100 6.2e-07
gastric cancer 1.400 7.5e-04
glioblastoma -1.400 5.6e-03
group 3 medulloblastoma 1.300 3.9e-03
hepatocellular carcinoma 1.200 7.2e-06
juvenile dermatomyositis 1.336 1.7e-09
medulloblastoma, large-cell 1.700 1.2e-04
non-small cell lung cancer 1.424 7.2e-14
osteosarcoma 2.516 5.9e-07
ovarian cancer -3.100 1.7e-07
pancreatic cancer 1.400 1.2e-03
pancreatic carcinoma 1.400 1.2e-03
Pick disease 1.900 1.8e-05
primary pancreatic ductal adenocarcinoma 1.352 2.5e-03
Rheumatoid arthritis 3.400 8.9e-05

Gene RIF (19)

AA Sequence

MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRI      1 - 70
LDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESR     71 - 140
RKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFE    141 - 210
GMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLT    211 - 280
TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKL    281 - 350
LQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK    351 - 420
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDV    421 - 490
EAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQD    491 - 560
SEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKD    561 - 630
DGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGD    631 - 700
TPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRN    701 - 770
KKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC    771 - 840
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQCRAVVERRVPF    841 - 910
IMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHG    911 - 980
TCQLCGDRMSECPICRKAIERRILLY                                                981 - 1006
//

Text Mined References (38)

PMID Year Title