Property Summary

NCBI Gene PubMed Count 17
PubMed Score 36.98
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQ      1 - 70
IWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELRE     71 - 140
VSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGC    141 - 210
GC                                                                        211 - 212
//

Text Mined References (22)

PMID Year Title