Property Summary

NCBI Gene PubMed Count 21
PubMed Score 5.48
PubTator Score 1.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.800 2.0e-07
astrocytic glioma -2.200 9.0e-03
Astrocytoma, Pilocytic -4.100 9.7e-14
atypical teratoid / rhabdoid tumor -3.600 1.1e-08
breast carcinoma 1.200 1.7e-04
ependymoma -2.100 1.4e-02
fibroadenoma 1.100 2.4e-02
glioblastoma -3.300 2.5e-10
group 3 medulloblastoma -1.500 2.5e-03
invasive ductal carcinoma 1.400 7.6e-05
medulloblastoma, large-cell -1.600 8.8e-04
oligodendroglioma -1.400 4.7e-02
osteosarcoma -2.020 1.8e-04
primitive neuroectodermal tumor -1.900 3.2e-03
subependymal giant cell astrocytoma -2.878 1.7e-02

Gene RIF (5)

AA Sequence

MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRIN      1 - 70
FKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEE     71 - 140
AMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLGGLFLPEDKSLVHTPSMTTSDLSTHSTTSLI    141 - 210
SNEEQFEDYGEGDDVDCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKK    211 - 280
INLLNDLEARLKNLKANSPNRKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKK    281 - 350
VTELENDSLTNGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVE    351 - 420
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQ    421 - 490
KEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQENYKLRDQN    491 - 560
DDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNP    561 - 630
SILEIKH                                                                   631 - 637
//

Text Mined References (26)

PMID Year Title