Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.75
PubTator Score 1.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.200 0.009
ependymoma -2.800 0.000
oligodendroglioma -1.600 0.000
glioblastoma -3.600 0.000
osteosarcoma -2.020 0.000
sonic hedgehog group medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -1.700 0.003
primitive neuroectodermal tumor -1.900 0.003
breast carcinoma 1.200 0.000
fibroadenoma 1.100 0.024
adult high grade glioma -3.800 0.000
pilocytic astrocytoma -4.100 0.000
subependymal giant cell astrocytoma -2.878 0.017
invasive ductal carcinoma 1.400 0.000

Synonym

Accession Q86YS3 Q52LI1 Q8N829 Q8NDT7 Q969D8 FIP4-Rab11
Symbols FIP4-Rab11
RAB11-FIP4

Gene

Gene RIF (4)

PMID Text
25745995 Results show the expression of Rab11-FIP4 upregulated in hepatocellular carcinoma (HCC) and correlated with poor prognosis. Rab11-FIP4 dramatically contributed to HCC metastasis via phosphorylation of PRAS40.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16148947 FIP3 and FIP4 serve to couple Rab11-positive vesicle traffic from recycling endosomes to the cleavage furrow/midbody where they are tethered prior to fusion events via interactions with Arf6 and the Exocyst.
12470645 Rab11-FIP4 interacts with Rab11 in a GTP-dependent manner and its overexpression condenses the Rab11 positive compartment in HeLa cells.

AA Sequence

MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRIN      1 - 70
FKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEE     71 - 140
AMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLGGLFLPEDKSLVHTPSMTTSDLSTHSTTSLI    141 - 210
SNEEQFEDYGEGDDVDCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKK    211 - 280
INLLNDLEARLKNLKANSPNRKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKK    281 - 350
VTELENDSLTNGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVE    351 - 420
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQ    421 - 490
KEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQENYKLRDQN    491 - 560
DDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNP    561 - 630
SILEIKH                                                                   631 - 637
//

Text Mined References (25)

PMID Year Title
25745995 2015 Hypoxia upregulates Rab11-family interacting protein 4 through HIF-1? to promote the metastasis of hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22522702 2012 Structural basis for Arf6-MKLP1 complex formation on the Flemming body responsible for cytokinesis.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19761540 2009 HCMV-encoded glycoprotein M (UL100) interacts with Rab11 effector protein FIP4.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
17030804 2006 Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1.
More...