Property Summary

NCBI Gene PubMed Count 8
PubMed Score 41.08
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 3.0e-29
non primary Sjogren syndrome sicca 891 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
diabetes mellitus 1728 0.0 4.0
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 5 11 3.121 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 2.200 3.0e-29
non primary Sjogren syndrome sicca -1.300 2.5e-02

Gene RIF (6)

AA Sequence

MLSCLKEEMPPQELTRRLATVITHVDEIMQQEVRPLMAVEIIEQLHRQFAILSGGRGEDGAPIITFPEFS      1 - 70
GFKHIPDEDFLNVMTYLTSIPSVEAASIGFIVVIDRRRDKWSSVKASLTRIAVAFPGNLQLIFILRPSRF     71 - 140
IQRTFTDIGIKYYRNEFKTKVPIIMVNSVSDLHGYIDKSQLTRELGGTLEYRHGQWVNHRTAIENFALTL    141 - 210
KTTAQMLQTFGSCLATAELPRSMLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKL    211 - 280
NLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDFCKAKLALDNLLEEQAEFTGIG    281 - 350
DSVMHVEQILKEHKKLEEKSQEPLEKAQLLALVGDQLIQSHHYAADAIRPRCVELRHLCDDFINGNKKKW    351 - 420
DILGKSLEFHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDIALNDIATFLGTVKEYPLLSPKEFYNEF    421 - 490
ELLLTLDAKAKAQKVLQRLDDVQEIFHKRQVSLMKLAAKQTRPVQPVAPHPESSPKWVSSKTSQPSTSVP    491 - 560
LARPLRTSEEPYTETELNSRGKEDDETKFEVKSEEIFESHHERGNPELEQQARLGDLSPRRRIIRDLLET    561 - 630
EEIYIKEIKSIIDGYITPMDFIWLKHLIPDVLQNNKDFLFGNIRELYEFHNRTFLKELEKCAENPELLAH    631 - 700
CFLKRKEDLQIYFKYHKNLPRARAIWQECQDCAYFGVCQRQLDHNLPLFKYLKGPSQRLIKYQMLLKGLL    701 - 770
DFESPEDMEIDPGELGGSAKDGPKRTKDSAFSTELQQALAVIEDLIKSCELAVDLAAVTECPDDIGKLGK    771 - 840
LLLHGPFSVWTIHKDRYKMKDLIRFKPSQRQIYLFERGIVFCKIRMEPGDQGLSPHYSFKKTMKLMTLSI    841 - 910
RQLGRGSHRKFEIASRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNIKDQGNPQFEMSTSKGSGAGS    911 - 980
GPWIKNMERATTSKEDPASSTGGIKGCSSREFSSMDTFEDCEGAEDMEKESSALSLAGLFQSDDSHETCS    981 - 1050
SKSAFLERGESSQGEKEERDEEETATRSTEEERAGASTGRLAPAGATAGFQARALRPRTSAQES         1051 - 1114
//

Text Mined References (12)

PMID Year Title