Property Summary

NCBI Gene PubMed Count 8
Grant Count 29
R01 Count 10
Funding $10,982,029.67
PubMed Score 41.63
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.300 0.025
lung carcinoma 2.200 0.000

Gene RIF (6)

PMID Text
20667095 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20667095 MCF2L2 Leu359Ile polymorphism is associated with decreased risk of diabetic nephropathy in female type 1 diabetes mellitus.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19648752 Results suggest that the genetic polymorphisms within MCF2L2 may confer an increased susceptibility to PCOS in the Chinese population. Data may provide a basis for further studies of the role of the MCF2L2 gene in the etiology of PCOS.
19648752 Observational study of gene-disease association. (HuGE Navigator)
18259684 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSCLKEEMPPQELTRRLATVITHVDEIMQQEVRPLMAVEIIEQLHRQFAILSGGRGEDGAPIITFPEFS      1 - 70
GFKHIPDEDFLNVMTYLTSIPSVEAASIGFIVVIDRRRDKWSSVKASLTRIAVAFPGNLQLIFILRPSRF     71 - 140
IQRTFTDIGIKYYRNEFKTKVPIIMVNSVSDLHGYIDKSQLTRELGGTLEYRHGQWVNHRTAIENFALTL    141 - 210
KTTAQMLQTFGSCLATAELPRSMLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKL    211 - 280
NLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDFCKAKLALDNLLEEQAEFTGIG    281 - 350
DSVMHVEQILKEHKKLEEKSQEPLEKAQLLALVGDQLIQSHHYAADAIRPRCVELRHLCDDFINGNKKKW    351 - 420
DILGKSLEFHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDIALNDIATFLGTVKEYPLLSPKEFYNEF    421 - 490
ELLLTLDAKAKAQKVLQRLDDVQEIFHKRQVSLMKLAAKQTRPVQPVAPHPESSPKWVSSKTSQPSTSVP    491 - 560
LARPLRTSEEPYTETELNSRGKEDDETKFEVKSEEIFESHHERGNPELEQQARLGDLSPRRRIIRDLLET    561 - 630
EEIYIKEIKSIIDGYITPMDFIWLKHLIPDVLQNNKDFLFGNIRELYEFHNRTFLKELEKCAENPELLAH    631 - 700
CFLKRKEDLQIYFKYHKNLPRARAIWQECQDCAYFGVCQRQLDHNLPLFKYLKGPSQRLIKYQMLLKGLL    701 - 770
DFESPEDMEIDPGELGGSAKDGPKRTKDSAFSTELQQALAVIEDLIKSCELAVDLAAVTECPDDIGKLGK    771 - 840
LLLHGPFSVWTIHKDRYKMKDLIRFKPSQRQIYLFERGIVFCKIRMEPGDQGLSPHYSFKKTMKLMTLSI    841 - 910
RQLGRGSHRKFEIASRNGLEKYILQAASKEIRDCWFSEISKLLMEQQNNIKDQGNPQFEMSTSKGSGAGS    911 - 980
GPWIKNMERATTSKEDPASSTGGIKGCSSREFSSMDTFEDCEGAEDMEKESSALSLAGLFQSDDSHETCS    981 - 1050
SKSAFLERGESSQGEKEERDEEETATRSTEEERAGASTGRLAPAGATAGFQARALRPRTSAQES         1051 - 1114
//

Text Mined References (12)

PMID Year Title
20667095 2010 Effects of MCF2L2, ADIPOQ and SOX2 genetic polymorphisms on the development of nephropathy in type 1 Diabetes Mellitus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19648752 2009 Family-based association study of the MCF2L2 gene and polycystic ovary syndrome.
18259684 2008 Search for type 2 diabetes susceptibility genes on chromosomes 1q, 3q and 12q.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...