Property Summary

NCBI Gene PubMed Count 6
PubMed Score 26.31
PubTator Score 14.71

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
22234308 This study suggests POTE may have a role in apoptosis in the human testis.
17996727 By immunohistochemistry we demonstrated that the POTE protein is expressed in primary spermatocytes, implying a role in spermatogenesis.
15276201 POTE protein isoforms were characterized and may have important signaling function in the reproductive system.

AA Sequence

MVAEVCSMPTASTVKKPFDLRSKMGKWCHHRFPCCRGSGKSNMGTSGDHDDSFMKMLRSKMGKCCRHCFP      1 - 70
CCRGSGTSNVGTSGDHENSFMKMLRSKMGKWCCHCFPCCRGSGKSNVGAWGDYDHSAFMEPRYHIRREDL     71 - 140
DKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKEKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTAL    141 - 210
IKAIQCQEDECVLMLLEHGADRNIPDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGV    211 - 280
HEQKQQVVKFLIKKKANLNVLDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHH    281 - 350
HVICELLSDYKEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK    351 - 420
KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQLSEEQNTGISQ    421 - 490
DEILTNKQKQIEVAEQKMNSELSLSHKKEEDLLRENSVLQEEIAMLRLELDETKHQNQLRENKILEEIES    491 - 560
VKEKTDKLLRAMQLNEEALTKTNI                                                  561 - 584
//

Text Mined References (7)

PMID Year Title
22234308 2012 POTE protein, a cancer-testis antigen, is highly expressed in spermatids in human testis and is associated with apoptotic cells.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
17996727 2008 Expression of POTE protein in human testis detected by novel monoclonal antibodies.
16364570 2006 Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil domains.
15276201 2004 Five POTE paralogs and their splice variants are expressed in human prostate and encode proteins of different lengths.
12475935 2002 POTE, a highly homologous gene family located on numerous chromosomes and expressed in prostate, ovary, testis, placenta, and prostate cancer.
10830953 2000 The DNA sequence of human chromosome 21.