Property Summary

NCBI Gene PubMed Count 32
Grant Count 45
R01 Count 34
Funding $5,902,550.54
PubMed Score 28.55
PubTator Score 36.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
25812748 Activator of G-protein Signaling 3 is an important regulator of esophageal squamous cell carcinoma proliferation
25740824 High GPSM1 gene methylation is associated with gastric tumor aggressiveness.
25480567 Results confirmed that Ric-8A can directly bind to AGS3S but failed to facilitate Galpha(i)-induced suppression of adenylyl cyclase, suggesting that it may not serve as a guanine exchange factor for AGS3/Galpha(i/o)-GDP complex in a cellular environment.
24510965 these results indicate that GRK6 complexes with AGS3-Galphai2 to regulate CXCR2-mediated leukocyte functions at different levels, including downstream effector activation, receptor trafficking, and expression at the cell membrane.
24307516 Our data indicate that decreased expression of AGS3 is correlated with reduced levels of p-CREB in the apoptotic model. The negative role of AGS3 in cell apoptosis was further confirmed by knocking down AGS3.
23945395 Data identified three new loci for type 2 diabetes with genome-wide significance: MIR129-LEP, GPSM1 and SLC16A13.
21209316 These results provide mechanistic insights into how reversible modulation of Galpha(i3) activity by AGS3 and GIV maintains the delicate equilibrium between promotion and inhibition of autophagy.
20716524 AGS3 receptor coupling to both Galphabetagamma and GPR-Galpha(i) offer additional flexibility for systems to respond and adapt to challenges and orchestrate complex behaviors
20237496 Observational study of gene-disease association. (HuGE Navigator)
20126274 unlike wild-type AGS3, over-expression of an AGS3 mutant lacking this modification fails to enhance macroautophagic activity. These observations imply that AGS3 phosphorylation may participate in the modulation of macroautophagy
More...

AA Sequence

MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYS      1 - 70
QLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQG     71 - 140
DKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPDVRETLCKASEFYERNLSLVKELGDRAAQGR    141 - 210
AYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSR    211 - 280
QLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALT    281 - 350
FAKKHLQISQEIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL    351 - 420
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRA    421 - 490
PSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQS    491 - 560
RRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPD    561 - 630
EDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS                             631 - 675
//

Text Mined References (40)

PMID Year Title
25812748 2015 Overexpression of activator of G-protein signaling 3 decreases the proliferation of esophageal squamous cell carcinoma.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25480567 2015 Activator of G protein signaling 3 forms a complex with resistance to inhibitors of cholinesterase-8A without promoting nucleotide exchange on G?(i3).
25416956 2014 A proteome-scale map of the human interactome network.
24510965 2014 G Protein-coupled receptor kinase-6 interacts with activator of G protein signaling-3 to regulate CXCR2-mediated cellular functions.
24307516 2014 A role for activator of G-protein signaling 3 (AGS3) in multiple myeloma.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21209316 2011 A GDI (AGS3) and a GEF (GIV) regulate autophagy by balancing G protein activity and growth factor signals.
More...