Property Summary

NCBI Gene PubMed Count 34
PubMed Score 28.55
PubTator Score 36.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (17)

AA Sequence

MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYS      1 - 70
QLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFDEAAVCCQRHLSIAQEQG     71 - 140
DKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPDVRETLCKASEFYERNLSLVKELGDRAAQGR    141 - 210
AYGNLGNTHYLLGNFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSR    211 - 280
QLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALT    281 - 350
FAKKHLQISQEIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL    351 - 420
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRA    421 - 490
PSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQS    491 - 560
RRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPD    561 - 630
EDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS                             631 - 675
//

Text Mined References (42)

PMID Year Title