Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.21
PubTator Score 3.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
urothelial carcinoma -2.300 0.000
astrocytic glioma -3.200 0.002
ependymoma -3.300 0.004
oligodendroglioma -3.000 0.007
osteosarcoma 1.696 0.000
glioblastoma -1.700 0.011
group 4 medulloblastoma -3.200 0.000
cystic fibrosis 2.446 0.000
atypical teratoid / rhabdoid tumor -1.600 0.038
medulloblastoma, large-cell -4.400 0.000
primitive neuroectodermal tumor -3.200 0.000
tuberculosis 2.400 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.004
intraductal papillary-mucinous neoplasm ... 1.800 0.048
active Crohn's disease 1.484 0.003
adult high grade glioma -2.800 0.000
psoriasis -1.100 0.000
Pick disease 1.100 0.000
invasive ductal carcinoma -1.200 0.006
ovarian cancer -2.200 0.000

AA Sequence

MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLLDRDTFSKSDPICVLYVQGVGNKEWREFGRTEVID      1 - 70
NTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPG     71 - 140
KKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVW    141 - 210
QAFKISVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYT    211 - 280
NSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEI    281 - 350
VQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVIN    351 - 420
HVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVS    421 - 490
SRGKYAERDIVQFVPFRDYIDRSGNHILSMARLAKDVLAEIPEQFLSYMRARGIKPSPAPPPYTPPTHVL    491 - 560
QTQI                                                                      561 - 564
//

Text Mined References (18)

PMID Year Title
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...