Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q86YQ2
Symbols BASE

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MLNVSGLFVLLCGLLVSSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTTGLQKPLSSAFDGVSGLLDI      1 - 70
FGPPLTNEINTVSIQVKNPQLLHVSIESTPQRKEATVQVPFTSELIVQLLTMKPFTANMQSDIKVQIRLE     71 - 140
KNVGGRYELAFGNCRLLPEAIWIQTGVQLAPAQNLLWQT                                   141 - 179
//

Text Mined References (9)

PMID Year Title