Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q86YQ2
Symbols BASE

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
18172302 The focus of this study is on the expression and regulation of the estrogen-regulated breast cancer and salivary gland expression (BASE) gene that may function as a breast cancer marker.
12538848 tissue distribution of BASE and its expression in cancer cell lines is described

AA Sequence

MLNVSGLFVLLCGLLVSSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTTGLQKPLSSAFDGVSGLLDI      1 - 70
FGPPLTNEINTVSIQVKNPQLLHVSIESTPQRKEATVQVPFTSELIVQLLTMKPFTANMQSDIKVQIRLE     71 - 140
KNVGGRYELAFGNCRLLPEAIWIQTGVQLAPAQNLLWQT                                   141 - 179
//

Text Mined References (9)

PMID Year Title
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
21787333 2011 Systematic nomenclature for the PLUNC/PSP/BSP30/SMGB proteins as a subfamily of the BPI fold-containing superfamily.
18172302 2008 Estrogen induces repression of the breast cancer and salivary gland expression gene in an estrogen receptor alpha-dependent manner.
17362520 2007 Expansion of the Bactericidal/Permeability Increasing-like (BPI-like) protein locus in cattle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739326 2004 Phylogenetic and evolutionary analysis of the PLUNC gene family.
12538848 2003 Discovery of the breast cancer gene BASE using a molecular approach to enrich for genes encoding membrane and secreted proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.