Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.21
PubTator Score 2.47

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.300 3.1e-02
astrocytoma 1.800 4.8e-04
gastric carcinoma 1.100 2.7e-02
glioblastoma multiforme 1.200 1.0e-22
group 3 medulloblastoma 1.200 4.0e-04
lung cancer 1.500 2.0e-03
osteosarcoma -2.014 2.5e-05
ovarian cancer 1.800 1.8e-06
pediatric high grade glioma 1.100 1.1e-04
primary pancreatic ductal adenocarcinoma 1.105 2.5e-03
psoriasis -2.000 2.0e-05

Gene RIF (6)

AA Sequence

MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGLLRATEATAMA      1 - 70
MGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGLTTVALKETSTEALMKSSPEE     71 - 140
RERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTS    141 - 210
SARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQ    211 - 280
IQGQRIIQQGLIRVANVPNTSLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKL    281 - 350
ALRKQLEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQC    351 - 420
KTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQGTAPAQAKAEP    421 - 490
TAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATAL    491 - 560
VSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPQSA    561 - 630
TWK                                                                       631 - 633
//

Text Mined References (35)

PMID Year Title