Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $44,850
PubMed Score 7.11
PubTator Score 2.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -2.000 0.000
glioblastoma multiforme 1.200 0.000
osteosarcoma -2.619 0.000
astrocytoma 1.800 0.000
primary pancreatic ductal adenocarcinoma 1.105 0.002
lung cancer 1.500 0.002
pediatric high grade glioma 1.100 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
gastric carcinoma 1.100 0.027
acute myeloid leukemia 1.300 0.031
ovarian cancer 1.800 0.000

 GWAS Trait (1)

Gene RIF (4)

PMID Text
23239876 These factors lead to a binding affinity hierarchy of p66alpha for the different MBD2 homologues (MBD2 approximately MBD3 > MBD3L1 approximately MBD3L2).
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19454010 Methyl-CpG-binding proteins MBD2 and p66alpha are identified to interact with HIV-1 Tat in Jurkat cell
18854154 Knockdown of GATA zinc finger domain containing 2A (GATAD2A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGLLRATEATAMA      1 - 70
MGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGLTTVALKETSTEALMKSSPEE     71 - 140
RERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTS    141 - 210
SARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQ    211 - 280
IQGQRIIQQGLIRVANVPNTSLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKL    281 - 350
ALRKQLEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQC    351 - 420
KTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQGTAPAQAKAEP    421 - 490
TAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATAL    491 - 560
VSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPQSA    561 - 630
TWK                                                                       631 - 633
//

Text Mined References (33)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23239876 2013 Unique features of the anti-parallel, heterodimeric coiled-coil interaction between methyl-cytosine binding domain 2 (MBD2) homologues and GATA zinc finger domain containing 2A (GATAD2A/p66?).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...