Property Summary

NCBI Gene PubMed Count 66
Grant Count 39
R01 Count 20
Funding $5,117,018.02
PubMed Score 420.86
PubTator Score 155.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 0.004
posterior fossa group A ependymoma -1.900 0.000
oligodendroglioma -1.200 0.015
osteosarcoma 1.250 0.000
group 3 medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.300 0.012
primitive neuroectodermal tumor -2.200 0.000
tuberculosis 2.000 0.000
intraductal papillary-mucinous neoplasm ... 1.900 0.007
interstitial cystitis -1.100 0.000
pediatric high grade glioma -1.100 0.002
ulcerative colitis -1.700 0.000
pituitary cancer 3.000 0.000
psoriasis 1.200 0.000

Gene RIF (53)

PMID Text
26427438 Data suggest that PGC-1alpha and PGC-1beta could play a role in regulating retina cell survival, and may be therapeutic targets to prevent retinal degeneration.
26351140 PGC-1(beta) and estrogen-related receptor alpha are aberrantly expressed in human colon cell lines and tumors.
25494292 RUNX3 is related to both the severity of AS and the function of daily life. PPARGC1B is related to the function of daily life.
25367151 Data show that PGC-1beta protein mediated the expression of proinflammatory cytokines and apoptosis through extracellular signal-regulated kinase (ERK), p38 and NF-kappaB in rheumatoid arthritis fibroblast-like synoviocytes.
24359475 Variation in the PPARGC1B gene may be associated with type 2 diabetes among middle-aged Chinese men and women.
23877360 cell apoptosis is orchestrated by the balance between several signaling pathways, and PGC-1beta takes part in these events in breast cancer cells mediated by the mTOR signaling pathway.
23866026 PPARgamma and PPARGC1B polymorphisms modulate the association between phthalate exposure and BC risk
23680128 PGC-1b, a coactivator of both LXR-alpha and SREBP-1, was markedly down-regulated by OEPAs compared with EPA.
23637848 PPARGC1B is associated with the susceptibility to ankylosing spondylitis in the Chinese Han population.
23264620 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells
More...

AA Sequence

MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSET      1 - 70
EPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAP     71 - 140
EKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQS    141 - 210
RSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVS    211 - 280
QEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD    281 - 350
VLCDVSKPYRLATPVYASLTPRSRPRPPKDSQASPGRPSSVEEVRIAASPKSTGPRPSLRPLRLEVKREV    351 - 420
RRPARLQQQEEEDEEEEEEEEEEEKEEEEEWGRKRPGRGLPWTKLGRKLESSVCPVRRSRRLNPELGPWL    421 - 490
TFADEPLVPSEPQGALPSLCLAPKAYDVERELGSPTDEDSGQDQQLLRGPQIPALESPCESGCGDMDEDP    491 - 560
SCPQLPPRDSPRCLMLALSQSDPTFGKKSFEQTLTVELCGTAGLTPPTTPPYKPTEEDPFKPDIKHSLGK    561 - 630
EIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRP    631 - 700
EGVLQRKVLRSWEPSGVHLEDWPQQGAPWAEAQAPGREEDRSCDAGAPPKDSTLLRDHEIRASLTKHFGL    701 - 770
LETALEEEDLASCKSPEYDTVFEDSSSSSGESSFLPEEEEEEGEEEEEDDEEEDSGVSPTCSDHCPYQSP    771 - 840
PSKANRQLCSRSRSSSGSSPCHSWSPATRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLS    841 - 910
SDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLR    911 - 980
HFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH                               981 - 1023
//

Text Mined References (70)

PMID Year Title
26427438 2016 The Potential Use of PGC-1? and PGC-1? to Protect the Retina by Stimulating Mitochondrial Repair.
26351140 2015 AMPK Promotes Aberrant PGC1? Expression To Support Human Colon Tumor Cell Survival.
25494292 2015 Analysis of clinical indexes and RUNX3, TBKBP1, PPARGC1B polymorphisms in Chinese Han patients with ankylosing spondylitis.
25367151 2014 Down-regulating peroxisome proliferator-activated receptor-gamma coactivator-1 beta alleviates the proinflammatory effect of rheumatoid arthritis fibroblast-like synoviocytes through inhibiting extracellular signal-regulated kinase, p38 and nuclear factor-kappaB activation.
24359475 2014 Genetic variation in the peroxisome proliferator-activated receptor (PPAR) and peroxisome proliferator-activated receptor gamma co-activator 1 (PGC1) gene families and type 2 diabetes.
23877360 2013 Apoptosis induced by PGC-1? in breast cancer cells is mediated by the mTOR pathway.
23866026 2013 PPAR? and PPARGC1B polymorphisms modify the association between phthalate metabolites and breast cancer risk.
23836911 2013 Peroxisome proliferator-activated receptor ? coactivator 1 (PGC-1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1 (Perm1) is a tissue-specific regulator of oxidative capacity in skeletal muscle cells.
23680128 2013 Oxidized eicosapentaenoic acids more potently reduce LXR?-induced cellular triacylglycerol via suppression of SREBP-1c, PGC-1? and GPA than its intact form.
23637848 2013 Analysis of PPARGC1B, RUNX3 and TBKBP1 polymorphisms in Chinese Han patients with ankylosing spondylitis: a case-control study.
More...