Property Summary

NCBI Gene PubMed Count 73
PubMed Score 463.06
PubTator Score 155.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 3.5e-03
atypical teratoid / rhabdoid tumor -1.700 1.3e-04
ependymoma -1.800 4.2e-03
glioblastoma -1.300 6.8e-04
group 3 medulloblastoma -2.200 1.1e-04
interstitial cystitis -1.100 3.7e-04
intraductal papillary-mucinous neoplasm ... 1.100 3.2e-02
medulloblastoma, large-cell -1.300 1.2e-02
oligodendroglioma -1.200 1.5e-02
osteosarcoma 1.250 1.5e-05
pediatric high grade glioma -1.100 1.9e-03
pituitary cancer 1.100 4.0e-06
primitive neuroectodermal tumor -2.200 3.0e-04
psoriasis 1.200 6.6e-86
tuberculosis 2.000 3.1e-07
ulcerative colitis -1.700 2.1e-05

Protein-protein Interaction (2)

Gene RIF (60)

AA Sequence

MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGELQWCPENSET      1 - 70
EPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAP     71 - 140
EKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWRQAGLRSKSQRPCVKADSTQDKKAPMMQSQS    141 - 210
RSCTELHKHLTSAQCCLQDRGLQPPCLQSPRLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVS    211 - 280
QEDMQAMVQLIRYMHTYCLPQRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQD    281 - 350
VLCDVSKPYRLATPVYASLTPRSRPRPPKDSQASPGRPSSVEEVRIAASPKSTGPRPSLRPLRLEVKREV    351 - 420
RRPARLQQQEEEDEEEEEEEEEEEKEEEEEWGRKRPGRGLPWTKLGRKLESSVCPVRRSRRLNPELGPWL    421 - 490
TFADEPLVPSEPQGALPSLCLAPKAYDVERELGSPTDEDSGQDQQLLRGPQIPALESPCESGCGDMDEDP    491 - 560
SCPQLPPRDSPRCLMLALSQSDPTFGKKSFEQTLTVELCGTAGLTPPTTPPYKPTEEDPFKPDIKHSLGK    561 - 630
EIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRP    631 - 700
EGVLQRKVLRSWEPSGVHLEDWPQQGAPWAEAQAPGREEDRSCDAGAPPKDSTLLRDHEIRASLTKHFGL    701 - 770
LETALEEEDLASCKSPEYDTVFEDSSSSSGESSFLPEEEEEEGEEEEEDDEEEDSGVSPTCSDHCPYQSP    771 - 840
PSKANRQLCSRSRSSSGSSPCHSWSPATRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLS    841 - 910
SDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLR    911 - 980
HFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH                               981 - 1023
//

Text Mined References (77)

PMID Year Title