Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.50
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Batten disease 13 4.091 2.0

Expression

Protein-protein Interaction (5)

AA Sequence

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNE      1 - 70
GVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLS     71 - 140
LGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSL    141 - 210
IPNVLWFEYTVTRAEARNRQRKLGTKLQ                                              211 - 238
//

Text Mined References (9)

PMID Year Title