Property Summary

NCBI Gene PubMed Count 52
Grant Count 105
R01 Count 54
Funding $14,665,462.31
PubMed Score 267.35
PubTator Score 97.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
interstitial lung disease -1.100 0.041
astrocytic glioma -2.200 0.001
ependymoma -3.200 0.003
oligodendroglioma -1.700 0.007
psoriasis 1.300 0.000
glioblastoma -2.300 0.000
osteosarcoma 1.804 0.009
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.900 0.001
Amyotrophic Lateral Sclerosis 1.028 0.001
Atopic dermatitis 1.100 0.000
adrenocortical carcinoma 1.887 0.001
tuberculosis -1.600 0.000
colon cancer 2.000 0.000
lung cancer 2.600 0.000
active Crohn's disease 1.427 0.033
ulcerative colitis 1.400 0.000
diabetes mellitus -1.200 0.003
interstitial cystitis -1.400 0.003
adult high grade glioma -2.000 0.001
pilocytic astrocytoma -1.700 0.000
progressive supranuclear palsy 1.300 0.009
Breast cancer -1.500 0.000
gastric carcinoma 1.700 0.049
ductal carcinoma in situ 1.500 0.001
Down syndrome -1.400 0.001

Synonym

Accession Q86YM7 B2R688 O96003 Q86YM5 Homer-1
Symbols HOMER
SYN47
Ves-1
HOMER1A
HOMER1B
HOMER1C

Gene

PANTHER Protein Class (1)

Gene RIF (30)

PMID Text
26718835 The present study was undertaken to determine the expression and functional significance of Homer1b/c in multiple myeloma
26641965 The main focus of the present review is to offer an overview of the current knowledge about the potential role of Homer1a in depression and the signaling pathways responsible for Homer1a regulation. [review]
25712868 these findings provide evidence for a new role of Homer1 supporting the regulation of Cav1.2 channels by STIM1.
25551602 The mRNA levels of Homer1, IL-1beta, and TNF-alpha in coronary artery disease patients were significantly higher than those in the control group, but not Homer2 and Homer3.
24815486 Homer1 promotes lymphatic invasion and associates with lymph node metastasis and poor prognosis of intrahepatic cholangiocarcinoma.
24126708 data suggest that HOMER1 rs4704559 G allele has a protective role for the development of levodopa adverse effects
23821062 The uncoupling of synaptic protein homer 1c from target proteins activates store-operated calcium entry in a neurotransmitter-like manner in human neuroblastoma cells.
23685007 Overexpression of HOMER1A reduces neuropathic pain hypersensitivity.
23044706 Polymorphisms of DRD1, DLG4 and HOMER1 are associated with opiate abuse.
22749857 This review discusses the association of Homer 1 variants with the etiology of many neurological diseases, such as pain, mental retardation syndromes, Alzheimer's disease, schizophrenia, addiction and traumatic brain injury.
More...

AA Sequence

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPL     71 - 140
TPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATLKGNNAKLTAALLESTANVKQ    141 - 210
WKQQLAAYQEEAERLHKRVTELECVSSQANAVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNAREL    211 - 280
QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKL    281 - 350
LECS                                                                      351 - 354
//

Text Mined References (54)

PMID Year Title
26718835 2016 Cell adhesion downregulates the expression of Homer1b/c and contributes to drug resistance in multiple myeloma cells.
26641965 2016 Signaling pathways regulating Homer1a expression: implications for antidepressant therapy.
25712868 2015 Homer proteins mediate the interaction between STIM1 and Cav1.2 channels.
25551602 2014 Diagnostic potential of differentially expressed Homer1, IL-1?, and TNF-? in coronary artery disease.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
24815486 2014 Identification of Homer1 as a potential prognostic marker for intrahepatic cholangiocarcinoma.
24126708 2014 Association of common genetic variants of HOMER1 gene with levodopa adverse effects in Parkinson's disease patients.
23821062 2013 The uncoupling of synaptic protein homer 1c from target proteins activates store-operated calcium entry in a neurotransmitter-like manner in human neuroblastoma cells.
23685007 2013 Nerve injury-induced changes in Homer/glutamate receptor signaling contribute to the development and maintenance of neuropathic pain.
More...