Property Summary

NCBI Gene PubMed Count 55
PubMed Score 285.72
PubTator Score 97.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Disease of metabolism 18 0.0 1.0
Mental Depression 333 0.0 1.7

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.427 3.3e-02
active ulcerative colitis 1.110 7.7e-03
adrenocortical carcinoma 1.887 1.1e-03
adult high grade glioma -2.000 1.0e-03
Amyotrophic lateral sclerosis 1.028 6.7e-04
astrocytic glioma -2.200 1.1e-03
Astrocytoma, Pilocytic -1.700 1.6e-05
Atopic dermatitis 1.100 1.2e-04
atypical teratoid / rhabdoid tumor -2.200 4.0e-06
Breast cancer -1.100 2.9e-03
colon cancer 1.800 1.3e-02
diabetes mellitus -1.200 2.7e-03
Down syndrome -1.400 1.1e-03
ductal carcinoma in situ 1.500 1.4e-03
ependymoma -3.200 2.7e-03
gastric carcinoma 1.700 4.9e-02
glioblastoma -1.400 5.2e-06
interstitial cystitis -1.400 2.5e-03
interstitial lung disease -1.100 4.1e-02
lung cancer 2.600 6.4e-05
medulloblastoma -1.400 1.1e-04
medulloblastoma, large-cell -1.700 3.5e-04
oligodendroglioma -1.700 6.5e-03
osteosarcoma 1.804 9.0e-03
primitive neuroectodermal tumor -1.900 8.4e-04
progressive supranuclear palsy 1.300 9.2e-03
psoriasis 1.100 4.0e-06
tuberculosis -1.600 3.0e-05

Protein-protein Interaction (11)

Gene RIF (33)

AA Sequence

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPL     71 - 140
TPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATLKGNNAKLTAALLESTANVKQ    141 - 210
WKQQLAAYQEEAERLHKRVTELECVSSQANAVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNAREL    211 - 280
QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKL    281 - 350
LECS                                                                      351 - 354
//

Text Mined References (58)

PMID Year Title