Property Summary

NCBI Gene PubMed Count 52
PubMed Score 267.35
PubTator Score 97.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 3.16025553448041E-65
Breast cancer 3099 1.7059710439059E-12
atypical teratoid / rhabdoid tumor 4369 6.71626671215719E-9
glioblastoma 5572 3.28131792753161E-7
medulloblastoma 1524 8.08805015323485E-6
ulcerative colitis 2087 1.05803085573268E-5
pilocytic astrocytoma 3086 2.29964831491896E-5
tuberculosis 1563 3.0267411786454E-5
lung cancer 4473 6.37949502874576E-5
colon cancer 1475 1.00147396768264E-4
Atopic dermatitis 944 1.17456682362173E-4
medulloblastoma, large-cell 6234 2.97403286580317E-4
Amyotrophic Lateral Sclerosis 432 6.71147177475511E-4
primitive neuroectodermal tumor 3031 8.3881154260056E-4
adult high grade glioma 2148 0.00103990258327691
Down syndrome 548 0.00111016610708048
astrocytic glioma 2241 0.0011394454707284
adrenocortical carcinoma 1427 0.00114165425332925
ductal carcinoma in situ 1745 0.00143227301963955
interstitial cystitis 2299 0.00250076830194274
ependymoma 2514 0.00265162498415822
diabetes mellitus 1663 0.00271327690023201
oligodendroglioma 2849 0.00650237665408683
osteosarcoma 7933 0.00904683286162791
progressive supranuclear palsy 674 0.00917765473631056
active Crohn's disease 918 0.0326447025169728
interstitial lung disease 292 0.040868833143208
gastric carcinoma 832 0.0489022136105167
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0

Expression

  Differential Expression (28)

Disease log2 FC p
interstitial lung disease -1.100 0.041
astrocytic glioma -2.200 0.001
ependymoma -3.200 0.003
oligodendroglioma -1.700 0.007
psoriasis 1.300 0.000
glioblastoma -2.300 0.000
osteosarcoma 1.804 0.009
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.900 0.001
Amyotrophic Lateral Sclerosis 1.028 0.001
Atopic dermatitis 1.100 0.000
adrenocortical carcinoma 1.887 0.001
tuberculosis -1.600 0.000
colon cancer 2.000 0.000
lung cancer 2.600 0.000
active Crohn's disease 1.427 0.033
ulcerative colitis 1.400 0.000
diabetes mellitus -1.200 0.003
interstitial cystitis -1.400 0.003
adult high grade glioma -2.000 0.001
pilocytic astrocytoma -1.700 0.000
progressive supranuclear palsy 1.300 0.009
Breast cancer -1.500 0.000
gastric carcinoma 1.700 0.049
ductal carcinoma in situ 1.500 0.001
Down syndrome -1.400 0.001

Synonym

Accession Q86YM7 B2R688 O96003 Q86YM5 Homer-1
Symbols HOMER
SYN47
Ves-1
HOMER1A
HOMER1B
HOMER1C

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (30)

PMID Text
26718835 The present study was undertaken to determine the expression and functional significance of Homer1b/c in multiple myeloma
26641965 The main focus of the present review is to offer an overview of the current knowledge about the potential role of Homer1a in depression and the signaling pathways responsible for Homer1a regulation. [review]
25712868 these findings provide evidence for a new role of Homer1 supporting the regulation of Cav1.2 channels by STIM1.
25551602 The mRNA levels of Homer1, IL-1beta, and TNF-alpha in coronary artery disease patients were significantly higher than those in the control group, but not Homer2 and Homer3.
24815486 Homer1 promotes lymphatic invasion and associates with lymph node metastasis and poor prognosis of intrahepatic cholangiocarcinoma.
24126708 data suggest that HOMER1 rs4704559 G allele has a protective role for the development of levodopa adverse effects
23821062 The uncoupling of synaptic protein homer 1c from target proteins activates store-operated calcium entry in a neurotransmitter-like manner in human neuroblastoma cells.
23685007 Overexpression of HOMER1A reduces neuropathic pain hypersensitivity.
23044706 Polymorphisms of DRD1, DLG4 and HOMER1 are associated with opiate abuse.
22749857 This review discusses the association of Homer 1 variants with the etiology of many neurological diseases, such as pain, mental retardation syndromes, Alzheimer's disease, schizophrenia, addiction and traumatic brain injury.
More...

AA Sequence

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKT      1 - 70
SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPL     71 - 140
TPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAISKHWEAELATLKGNNAKLTAALLESTANVKQ    141 - 210
WKQQLAAYQEEAERLHKRVTELECVSSQANAVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNAREL    211 - 280
QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKL    281 - 350
LECS                                                                      351 - 354
//

Text Mined References (54)

PMID Year Title
26718835 2016 Cell adhesion downregulates the expression of Homer1b/c and contributes to drug resistance in multiple myeloma cells.
26641965 2016 Signaling pathways regulating Homer1a expression: implications for antidepressant therapy.
25712868 2015 Homer proteins mediate the interaction between STIM1 and Cav1.2 channels.
25551602 2014 Diagnostic potential of differentially expressed Homer1, IL-1?, and TNF-? in coronary artery disease.
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
24815486 2014 Identification of Homer1 as a potential prognostic marker for intrahepatic cholangiocarcinoma.
24126708 2014 Association of common genetic variants of HOMER1 gene with levodopa adverse effects in Parkinson's disease patients.
23821062 2013 The uncoupling of synaptic protein homer 1c from target proteins activates store-operated calcium entry in a neurotransmitter-like manner in human neuroblastoma cells.
23685007 2013 Nerve injury-induced changes in Homer/glutamate receptor signaling contribute to the development and maintenance of neuropathic pain.
More...