Property Summary

NCBI Gene PubMed Count 171
Grant Count 163
R01 Count 86
Funding $41,750,214.64
PubMed Score 1987.72
PubTator Score 589.30

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86YL7 A9Z1Y2 B2R6J8 E9PB68 F6QWX5 O60836 O95128 Q7L375 Q8NBQ8 Q8NBR3
Symbols T1A
GP36
GP40
Gp38
OTS8
T1A2
TI1A
T1A-2
AGGRUS
HT1A-1
PA2.26

Gene

PDB

3WSR   4YO0  

Gene RIF (161)

PMID Text
27069135 Expression of Podoplanin in Non-melanoma Skin Cancers and Actinic Keratosis
27066737 this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role.
27031228 LpMab-12 could serve as a new diagnostic tool for determining whether hPDPN possesses the sialylation on Thr52, a site-specific post-translational modification critical for the hPDPN association with CLEC-2.
26867059 These data support a role of podoplanin as an antiapoptotic prosurvival factor in angiotensin II-induced injury of human podocytes.
26728373 Data show that the CHO cell line with the stable and high expression of recombinant podoplanin (PDPN)-enhanced green fluorescent protein (EGFP) was constructed successfully, and it could induce platelet aggregation.
26722465 In esophageal squamous cell carcinoma, high p-mTOR expression was significantly associated with high podoplanin expression and high tumor grade
26700593 podoplanin membrane expression, not only its localization, is a useful prognostic indicator of lung squamous cell carcinoma
26684030 High podoplanin expression is associated with lung metastasis.
26492618 Almost all anti-PDPN MAbs recognize a platelet aggregation-inducing (PLAG) domain.
26339454 Podoplanin increased migration of tumor cells and enhanced tube formation activity in endothelial cells independent from VEGF.
More...

AA Sequence

MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT      1 - 70
SVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLL     71 - 140
AIGFIGAIIVVVMRKMSGRYSP                                                    141 - 162
//

Text Mined References (172)

PMID Year Title
27069135 2016 Expression of Podoplanin in Non-melanoma Skin Cancers and Actinic Keratosis.
27066737 2016 Pathological lymphangiogenesis is modulated by galectin-8-dependent crosstalk between podoplanin and integrin-associated VEGFR-3.
27031228 2016 LpMab-12 Established by CasMab Technology Specifically Detects Sialylated O-Glycan on Thr52 of Platelet Aggregation-Stimulating Domain of Human Podoplanin.
26867059 2016 Regulation of podoplanin expression by microRNA-29b associates with its antiapoptotic effect in angiotensin II-induced injury of human podocytes.
26728373 2016 [Stable expression of recombinant human podoplanin in Chinese hamster ovary (CHO) cells].
26722465 2015 Phosphorylated mTOR expression correlates with podoplanin expression and high tumor grade in esophageal squamous cell carcinoma.
26700593 2015 Podoplanin expression is correlated with the prognosis of lung squamous cell carcinoma.
26684030 2016 Targeting a novel domain in podoplanin for inhibiting platelet-mediated tumor metastasis.
26492618 2015 Monoclonal Antibody LpMab-9 Recognizes O-glycosylated N-Terminus of Human Podoplanin.
26339454 2015 Podoplanin increases migration and angiogenesis in malignant glioma.
More...