Property Summary

NCBI Gene PubMed Count 171
PubMed Score 1987.72
PubTator Score 589.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.934262568757E-21
pilocytic astrocytoma 3086 2.18920551454051E-14
ovarian cancer 8492 1.08813592368878E-11
malignant mesothelioma 3163 4.43984304745048E-10
posterior fossa group A ependymoma 1511 1.21715193564209E-9
Breast cancer 3099 1.23015069999158E-9
lung cancer 4473 1.02787560357212E-6
lung adenocarcinoma 2714 5.16371575276045E-6
adult high grade glioma 2148 9.34994552296177E-6
ulcerative colitis 2087 1.53823326455905E-5
sonic hedgehog group medulloblastoma 1482 4.36485455646368E-5
acute quadriplegic myopathy 1157 1.5040675844807E-4
osteosarcoma 7933 0.00193067715074057
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00227657735969072
cutaneous lupus erythematosus 1056 0.00429867013327984
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00518146104360533
interstitial cystitis 2299 0.00638739675321756
gastric carcinoma 832 0.00657793684719461
glioblastoma 5572 0.00698053848390883
primary pancreatic ductal adenocarcinoma 1271 0.0111218807742348
atypical teratoid / rhabdoid tumor 4369 0.0111338622904989
psoriasis 6685 0.0115374006913207
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0122807232015352
pancreatic cancer 2300 0.0216378948180507
oligodendroglioma 2849 0.0368144893369701
subependymal giant cell astrocytoma 2287 0.0413979106063203
astrocytic glioma 2241 0.0437996146065091

Expression

Synonym

Accession Q86YL7 A9Z1Y2 B2R6J8 E9PB68 F6QWX5 O60836 O95128 Q7L375 Q8NBQ8 Q8NBR3
Symbols T1A
GP36
GP40
Gp38
OTS8
T1A2
TI1A
T1A-2
AGGRUS
HT1A-1
PA2.26

Gene

PDB

3WSR   4YO0  

  Ortholog (5)

Gene RIF (161)

PMID Text
27069135 Expression of Podoplanin in Non-melanoma Skin Cancers and Actinic Keratosis
27066737 this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role.
27031228 LpMab-12 could serve as a new diagnostic tool for determining whether hPDPN possesses the sialylation on Thr52, a site-specific post-translational modification critical for the hPDPN association with CLEC-2.
26867059 These data support a role of podoplanin as an antiapoptotic prosurvival factor in angiotensin II-induced injury of human podocytes.
26728373 Data show that the CHO cell line with the stable and high expression of recombinant podoplanin (PDPN)-enhanced green fluorescent protein (EGFP) was constructed successfully, and it could induce platelet aggregation.
26722465 In esophageal squamous cell carcinoma, high p-mTOR expression was significantly associated with high podoplanin expression and high tumor grade
26700593 podoplanin membrane expression, not only its localization, is a useful prognostic indicator of lung squamous cell carcinoma
26684030 High podoplanin expression is associated with lung metastasis.
26492618 Almost all anti-PDPN MAbs recognize a platelet aggregation-inducing (PLAG) domain.
26339454 Podoplanin increased migration of tumor cells and enhanced tube formation activity in endothelial cells independent from VEGF.
More...

AA Sequence

MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT      1 - 70
SVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLL     71 - 140
AIGFIGAIIVVVMRKMSGRYSP                                                    141 - 162
//

Text Mined References (172)

PMID Year Title
27069135 2016 Expression of Podoplanin in Non-melanoma Skin Cancers and Actinic Keratosis.
27066737 2016 Pathological lymphangiogenesis is modulated by galectin-8-dependent crosstalk between podoplanin and integrin-associated VEGFR-3.
27031228 2016 LpMab-12 Established by CasMab Technology Specifically Detects Sialylated O-Glycan on Thr52 of Platelet Aggregation-Stimulating Domain of Human Podoplanin.
26867059 2016 Regulation of podoplanin expression by microRNA-29b associates with its antiapoptotic effect in angiotensin II-induced injury of human podocytes.
26728373 2016 [Stable expression of recombinant human podoplanin in Chinese hamster ovary (CHO) cells].
26722465 2015 Phosphorylated mTOR expression correlates with podoplanin expression and high tumor grade in esophageal squamous cell carcinoma.
26700593 2015 Podoplanin expression is correlated with the prognosis of lung squamous cell carcinoma.
26684030 2016 Targeting a novel domain in podoplanin for inhibiting platelet-mediated tumor metastasis.
26492618 2015 Monoclonal Antibody LpMab-9 Recognizes O-glycosylated N-Terminus of Human Podoplanin.
26339454 2015 Podoplanin increases migration and angiogenesis in malignant glioma.
More...