Property Summary

NCBI Gene PubMed Count 194
PubMed Score 2142.92
PubTator Score 589.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma -1.400 3.4e-05
acute quadriplegic myopathy 1.055 1.5e-04
adult high grade glioma 1.500 4.5e-05
astrocytic glioma -1.100 4.4e-02
Astrocytoma, Pilocytic 2.600 7.0e-12
atypical teratoid / rhabdoid tumor 1.800 2.4e-02
Breast cancer -1.400 1.2e-09
cutaneous lupus erythematosus 1.100 4.3e-03
ependymoma 1.300 1.9e-05
gastric carcinoma 1.600 6.6e-03
glioblastoma 1.800 6.4e-04
interstitial cystitis 1.100 4.8e-03
intraductal papillary-mucinous adenoma (... -2.300 2.3e-03
intraductal papillary-mucinous carcinoma... -2.200 5.2e-03
intraductal papillary-mucinous neoplasm ... -2.600 1.2e-02
lung adenocarcinoma -1.302 5.2e-06
lung cancer -3.400 4.7e-05
lung carcinoma -1.600 3.9e-21
oligodendroglioma -1.200 3.7e-02
osteosarcoma 2.119 1.9e-03
ovarian cancer -3.700 1.1e-11
pancreatic cancer 1.500 2.2e-02
primary pancreatic ductal adenocarcinoma 1.505 1.1e-02
psoriasis -1.300 1.2e-02
sonic hedgehog group medulloblastoma 1.600 1.2e-04
subependymal giant cell astrocytoma 2.407 4.1e-02
ulcerative colitis 1.400 1.8e-04

Protein-protein Interaction (3)

Gene RIF (179)

AA Sequence

MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT      1 - 70
SVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLL     71 - 140
AIGFIGAIIVVVMRKMSGRYSP                                                    141 - 162
//

Text Mined References (196)

PMID Year Title