Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.93
PubTator Score 3.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.4e-05
Breast cancer -1.900 9.4e-08
ependymoma 1.200 7.3e-03
glioblastoma -1.100 5.2e-04
group 3 medulloblastoma 1.600 8.5e-05
interstitial cystitis -1.200 3.4e-03
intraductal papillary-mucinous adenoma (... -1.400 1.8e-04
intraductal papillary-mucinous neoplasm ... -1.400 3.8e-03
medulloblastoma, large-cell 1.200 6.4e-04
oligodendroglioma 1.200 3.8e-03
osteosarcoma -1.202 7.8e-03
ovarian cancer -2.100 3.2e-07
pancreatic cancer 1.600 4.2e-05
pancreatic carcinoma 1.600 4.2e-05
spina bifida -2.537 3.5e-02

Synonym

Accession Q86YL5 B6VF03 B9EG53
Symbols Inm01
TDRP1
TDRP2
C8orf42

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKSK      1 - 70
GTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDDA     71 - 140
KGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE                             141 - 185
//

Text Mined References (10)

PMID Year Title