Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.48
PubTator Score 3.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (3)

PMID Text
24667176 Single nucleotide polymorphisms on genetic loci SOD2, MBP and C8orf42were not found significantly associated with advanced age-related macular degeneration in a Chinese cohort
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170638 These current data demonstrated that as a nuclear factor, TDRP1 might play an important role in spermatogenesis.

AA Sequence

MWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKSK      1 - 70
GTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDDA     71 - 140
KGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE                             141 - 185
//

Text Mined References (10)

PMID Year Title
24667176 2014 Association study of newly identified age-related macular degeneration susceptible loci SOD2, MBP, and C8orf42 in Han Chinese population.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20170638 2010 Molecular cloning of a novel nuclear factor, TDRP1, in spermatogenic cells of testis and its relationship with spermatogenesis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15163304 2004 Gene expression profiling in human insulinoma tissue: genes involved in the insulin secretion pathway and cloning of novel full-length cDNAs.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.