Property Summary

NCBI Gene PubMed Count 8
Grant Count 8
R01 Count 8
Funding $727,641.34
PubMed Score 23.36
PubTator Score 10.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.293 0.000
primary pancreatic ductal adenocarcinoma 1.151 0.006
ovarian cancer 1.600 0.000
pancreatic cancer 1.100 0.002

Gene RIF (2)

PMID Text
24278021 SPOC1-mediated restriction imposed upon Ad growth is relieved by its functional association with the Ad major core protein pVII that enters with the viral genome, followed by E1B-55K/E4orf6-dependent proteasomal degradation of SPOC1.
19638409 SPOC1 modulates chromatin structure and that tight regulation of its expression levels and subcellular localization during mitosis are crucial for proper chromosome condensation and cell division.

AA Sequence

MDSDSCAAAFHPEEYSPSCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANSTAGTIDSDGW      1 - 70
DAGFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLL     71 - 140
KLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQVVFR    141 - 210
DEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS    211 - 280
KFDIRRSNRSRTGSRKLFLD                                                      281 - 300
//

Text Mined References (9)

PMID Year Title
24278021 2013 SPOC1-mediated antiviral host cell response is antagonized early in human adenovirus type 5 infection.
19638409 2009 SPOC1: a novel PHD-containing protein modulating chromatin structure and mitotic chromosome condensation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15825179 2005 SPOC1, a novel PHD-finger protein: association with residual disease and survival in ovarian cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.