Property Summary

NCBI Gene PubMed Count 23
PubMed Score 23.34
PubTator Score 23.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma -1.613 4.9e-06
ependymoma 1.200 8.3e-06
group 3 medulloblastoma 1.100 8.5e-04
intraductal papillary-mucinous adenoma (... 1.100 1.9e-03
osteosarcoma -1.628 7.7e-06
ovarian cancer -1.100 5.3e-04
pancreatic ductal adenocarcinoma liver m... -1.111 6.3e-03
tuberculosis 1.100 9.2e-08

Gene RIF (14)

AA Sequence

MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR      1 - 70
CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG     71 - 140
IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK    141 - 210
VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA    211 - 280
FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRE    281 - 350
RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS                         351 - 399
//

Text Mined References (24)

PMID Year Title