Property Summary

NCBI Gene PubMed Count 22
Grant Count 67
R01 Count 38
Funding $6,486,067.74
PubMed Score 48.41
PubTator Score 23.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q86YH6 Q33DR4 Q4G158 Q5VU38 Q5VU39 Q9NR58
Symbols DLP1
hDLP1
COQ10D3
C6orf210
bA59I9.3

Gene

PANTHER Protein Class (2)

Gene RIF (14)

PMID Text
25780306 Decreased PDSS2 expression is an unfavorable prognostic factor for hepatocellular carcinoma, and PDSS2 has potent anticancer activity in HCC tissues and HepG2 cells.
25330808 PDSS2 encodes a putative tumor suppressor, and its expression is regulated by hypermethylation of its promoter in gastric cancer cells.
25189544 Decreased PDSS2 mRNA levels were detected in HCC tissues of 56 patients, correlated with shorter disease-specific survival, and was identified as an independent prognostic factor
24608273 PDSS2 has tumor-suppressing activity in human lung cancer cells by enhancing apoptosis and inhibiting tumorigenic capacity.
23926186 Human PDSS2 polymorphisms are associated with podocyte diseases. A deficiency of coenzyme Q10 is manifested in lymphoblastoid cell lines derived from focal segmental glomerulosclerosis patients.
23312889 Loss of PDSS2 expression is associated with non-small cell lung cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20507940 Observational study of gene-disease association. (HuGE Navigator)
20051244 Data show that expression of either dlp1 or dps1 recovered the thermo-sensitive growth of an E. coli ispB(R321A) mutant and restored IspB activity and production of Coenzyme Q-8.
More...

AA Sequence

MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR      1 - 70
CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG     71 - 140
IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK    141 - 210
VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA    211 - 280
FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRE    281 - 350
RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS                         351 - 399
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25780306 2015 Decaprenyl diphosphate synthase subunit 2 as a prognosis factor in hepatocellular carcinoma.
25330808 2014 Decreased expression of prenyl diphosphate synthase subunit 2 correlates with reduced survival of patients with gastric cancer.
25189544 2014 Clinical utility of PDSS2 expression to stratify patients at risk for recurrence of hepatocellular carcinoma.
24608273 2014 The tumor-suppressing activity of the prenyl diphosphate synthase subunit 2 gene in lung cancer cells.
23926186 2013 Focal segmental glomerulosclerosis is associated with a PDSS2 haplotype and, independently, with a decreased content of coenzyme Q10.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23312889 2013 Decrease of PDSS2 expression, a novel tumor suppressor, in non-small cell lung cancer.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...