Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.25
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
24236047 ZNF280B upregulates GUCY1A3 expression and downregulates TP53 in prostate cancer cells.

AA Sequence

MEQSCEEEKEPEPQKNIQETKQVDDEDAELIFVGVEHVNEDAELIFVGVTSNSKPVVSNILNRVTPGSWS      1 - 70
RRKKYDHLRKDTARKLQPKSHETVTSEAVTVLPASQLESRSTDSPIIIEPLSKPDYRNSSPQVVPNNSSE     71 - 140
LPSPLITFTDSLHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGIIEGNSSASFPSDTFHT    141 - 210
MNTQQSTPSNNVHTSLSHVQNGAPFPAAFPKDNIHFKPINTNLDRENELAKTDILSLTSQNKTFDPKKEN    211 - 280
PIVLLSDFYYGQHKGEGQPEQKTHTTFKCLSCVKVLKNVKFMNHVKHHLEFEKQRNDSWENHTTCQHCHR    281 - 350
QFPTPFQLQCHIENVHTAQEPSTVCKICELSFETDQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVET    351 - 420
HFRTCHENTKNLLCPFCLKIFKTATPYMCHYRGHWGKSAHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPK    421 - 490
QLEGLPPETKVTIQVSLEPLQPGSVDVASITVSTSDSEPSLPRSKSKISKKSH                     491 - 543
//

Text Mined References (10)

PMID Year Title
24236047 2013 Zinc Finger 280B regulates sGC?1 and p53 in prostate cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.