Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.0e-07
psoriasis 6694 1.1e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.821 1.0e-07
psoriasis 1.300 1.1e-04

AA Sequence

MPAWIFVNRSLALGKIRCFGFDMDYTLAAYKSPAYEALTFELLLERLVCIGYPHEILRYTYDPTFPTRRL      1 - 70
VFDELYGNLLKVDAHGNVLLGAYGFTFLSEAEIWSFYPSKFIQRDDLQCFYILNMLFNLPETYLYACLVD     71 - 140
FFSGCSRYTNCDTGYQHGNLFMSFRSLFQDVTDAMNNIHQSGCLKKTLEDLEKYVKKDPRLPILLGKMKE    141 - 210
VGKVFLATNSSYNYTNAIMTYLFSISEAEASGRPWRSYFDLIVVDTQKPHFFAEGLVLRQVNTDSGKLHV    211 - 280
GTSTGPHQHCAVYSGGSSDMVCELLGVRGMDILYIGDHIFGDILKSKKRQGWRTCLVVPELSWELDIWAQ    281 - 350
EKERLEELKRLDTHLADIYQHMDGSSCELQVINFTKREIQMPHESVVEQEQANLDPASCLLSCNQRSLPA    351 - 420
KSCLSSAI                                                                  421 - 428
//

Text Mined References (3)

PMID Year Title