Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.01523290116518E-7
psoriasis 6685 1.10452093403012E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.821 0.000
psoriasis 1.300 0.000

Synonym

Accession Q86YG4
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG

AA Sequence

MPAWIFVNRSLALGKIRCFGFDMDYTLAAYKSPAYEALTFELLLERLVCIGYPHEILRYTYDPTFPTRRL      1 - 70
VFDELYGNLLKVDAHGNVLLGAYGFTFLSEAEIWSFYPSKFIQRDDLQCFYILNMLFNLPETYLYACLVD     71 - 140
FFSGCSRYTNCDTGYQHGNLFMSFRSLFQDVTDAMNNIHQSGCLKKTLEDLEKYVKKDPRLPILLGKMKE    141 - 210
VGKVFLATNSSYNYTNAIMTYLFSISEAEASGRPWRSYFDLIVVDTQKPHFFAEGLVLRQVNTDSGKLHV    211 - 280
GTSTGPHQHCAVYSGGSSDMVCELLGVRGMDILYIGDHIFGDILKSKKRQGWRTCLVVPELSWELDIWAQ    281 - 350
EKERLEELKRLDTHLADIYQHMDGSSCELQVINFTKREIQMPHESVVEQEQANLDPASCLLSCNQRSLPA    351 - 420
KSCLSSAI                                                                  421 - 428
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.