Property Summary

NCBI Gene PubMed Count 14
Grant Count 16
R01 Count 16
Funding $540,571.74
PubMed Score 12.48
PubTator Score 6.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis -1.700 0.002
osteosarcoma 1.423 0.001
glioblastoma -1.700 0.020
group 4 medulloblastoma -2.000 0.002
medulloblastoma, large-cell -2.700 0.000
intraductal papillary-mucinous adenoma (... -2.900 0.000
intraductal papillary-mucinous carcinoma... -2.900 0.000
intraductal papillary-mucinous neoplasm ... -2.900 0.004
lung cancer 1.100 0.001
colon cancer -1.200 0.029
interstitial cystitis -1.200 0.009
cystic fibrosis 1.100 0.001
adult high grade glioma -1.300 0.005
severe Alzheimer's disease -1.047 0.042
Pick disease -1.100 0.001
ovarian cancer -2.100 0.000
chronic rhinosinusitis -1.621 0.008

Gene RIF (5)

PMID Text
24993635 The abundance of DZIP1-associated mRNAs increased with treatment.
24072710 Dzip1-dependent stabilization of Spop/HIB is evolutionarily conserved and essential for proper regulation of Gli/Ci proteins in the Hh pathway.
21878643 reversible phosphorylation of Dzip1, which is controlled by the antagonistic action of CK2 and B56-containing PP2As, has an important impact on the stability of Gli transcription factors and Hh signaling.
15081113 DZIP may associate with DAZ and its other cofactors in an RNA-binding protein complex that functions in both ES cells and germ cells
15081113 gene expression profiling [DZIP]

AA Sequence

MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQFRPRLESVDWR      1 - 70
RLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTS     71 - 140
QLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQ    141 - 210
AFLQSHIQRRHTEENSHFEYQKNAQIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEE    211 - 280
DFLKLFDRWKEEEKEKLVDEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFK    281 - 350
EDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEE    351 - 420
LGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPM    421 - 490
VHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINA    491 - 560
DIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQVSCKIEEKALLSSDQCSVSQMDTLSTGEV    561 - 630
PKMIQLPSKNRQLIRQKAVSTDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGP    631 - 700
LPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKVEKMFPHRKNVNKPVGGTNVP    701 - 770
EMFIKKEELQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKG    771 - 840
EGLQENESSTLKSSLVTVTDWSDTSDV                                               841 - 867
//

Text Mined References (16)

PMID Year Title
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
24993635 2014 Ribonomic analysis of human DZIP1 reveals its involvement in ribonucleoprotein complexes and stress granules.
24072710 2013 Stabilization of speckle-type POZ protein (Spop) by Daz interacting protein 1 (Dzip1) is essential for Gli turnover and the proper output of Hedgehog signaling.
23955340 2013 Centrosomal protein DZIP1 regulates Hedgehog signaling by promoting cytoplasmic retention of transcription factor GLI3 and affecting ciliogenesis.
21878643 2011 The antagonistic action of B56-containing protein phosphatase 2As and casein kinase 2 controls the phosphorylation and Gli turnover function of Daz interacting protein 1.
19852954 2010 The Zn finger protein Iguana impacts Hedgehog signaling by promoting ciliogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15081113 2004 Identification of a novel gene, DZIP (DAZ-interacting protein), that encodes a protein that interacts with DAZ (deleted in azoospermia) and is expressed in embryonic stem cells and germ cells.
More...