Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.48
PubTator Score 6.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 6.80245093477316E-7
ovarian cancer 8492 4.60937709994922E-5
medulloblastoma, large-cell 6234 1.28250900118349E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.42709982160334E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.48250029348028E-4
lung cancer 4473 9.16595019649679E-4
cystic fibrosis 1670 0.00115948538881011
osteosarcoma 7933 0.00132476397894383
Pick disease 1893 0.00145258072280575
group 4 medulloblastoma 1875 0.00161131310205734
psoriasis 6685 0.00239919112857177
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0040029819455639
adult high grade glioma 2148 0.00486238769960966
chronic rhinosinusitis 512 0.0075971993708198
interstitial cystitis 2299 0.00921754794166341
glioblastoma 5572 0.0199430357949382
colon cancer 1475 0.0288173868748079
severe Alzheimer's disease 49 0.0417254934400745
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Acrodermatitis enteropathica 18 3.773 1.9

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis -1.700 0.002
osteosarcoma 1.423 0.001
glioblastoma -1.700 0.020
group 4 medulloblastoma -2.000 0.002
medulloblastoma, large-cell -2.700 0.000
intraductal papillary-mucinous adenoma (... -2.900 0.000
intraductal papillary-mucinous carcinoma... -2.900 0.000
intraductal papillary-mucinous neoplasm ... -2.900 0.004
lung cancer 1.100 0.001
colon cancer -1.200 0.029
interstitial cystitis -1.200 0.009
cystic fibrosis 1.100 0.001
adult high grade glioma -1.300 0.005
severe Alzheimer's disease -1.047 0.042
Pick disease -1.100 0.001
ovarian cancer -2.100 0.000
chronic rhinosinusitis -1.621 0.008

Synonym

Accession Q86YF9 Q5W078 Q5W079 Q8WY45 Q8WY46 Q9UGA5 Q9Y2K0
Symbols DZIP
DZIPt1

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Gene RIF (5)

PMID Text
24993635 The abundance of DZIP1-associated mRNAs increased with treatment.
24072710 Dzip1-dependent stabilization of Spop/HIB is evolutionarily conserved and essential for proper regulation of Gli/Ci proteins in the Hh pathway.
21878643 reversible phosphorylation of Dzip1, which is controlled by the antagonistic action of CK2 and B56-containing PP2As, has an important impact on the stability of Gli transcription factors and Hh signaling.
15081113 DZIP may associate with DAZ and its other cofactors in an RNA-binding protein complex that functions in both ES cells and germ cells
15081113 gene expression profiling [DZIP]

AA Sequence

MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQFRPRLESVDWR      1 - 70
RLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTS     71 - 140
QLHTLEERLRLSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQ    141 - 210
AFLQSHIQRRHTEENSHFEYQKNAQIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEE    211 - 280
DFLKLFDRWKEEEKEKLVDEMEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFK    281 - 350
EDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEE    351 - 420
LGQRLQEQNELIITQRQQIKDFTCNPLNSISEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPM    421 - 490
VHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINA    491 - 560
DIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQVSCKIEEKALLSSDQCSVSQMDTLSTGEV    561 - 630
PKMIQLPSKNRQLIRQKAVSTDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGP    631 - 700
LPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKVEKMFPHRKNVNKPVGGTNVP    701 - 770
EMFIKKEELQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKG    771 - 840
EGLQENESSTLKSSLVTVTDWSDTSDV                                               841 - 867
//

Text Mined References (16)

PMID Year Title
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
24993635 2014 Ribonomic analysis of human DZIP1 reveals its involvement in ribonucleoprotein complexes and stress granules.
24072710 2013 Stabilization of speckle-type POZ protein (Spop) by Daz interacting protein 1 (Dzip1) is essential for Gli turnover and the proper output of Hedgehog signaling.
23955340 2013 Centrosomal protein DZIP1 regulates Hedgehog signaling by promoting cytoplasmic retention of transcription factor GLI3 and affecting ciliogenesis.
21878643 2011 The antagonistic action of B56-containing protein phosphatase 2As and casein kinase 2 controls the phosphorylation and Gli turnover function of Daz interacting protein 1.
19852954 2010 The Zn finger protein Iguana impacts Hedgehog signaling by promoting ciliogenesis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15081113 2004 Identification of a novel gene, DZIP (DAZ-interacting protein), that encodes a protein that interacts with DAZ (deleted in azoospermia) and is expressed in embryonic stem cells and germ cells.
More...