Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.600 1.6e-03
glioblastoma -1.400 1.2e-02
group 3 medulloblastoma 1.100 5.0e-02
invasive ductal carcinoma -1.400 7.2e-03
malignant mesothelioma -2.700 1.2e-07
medulloblastoma, large-cell -1.200 3.4e-03
osteosarcoma -1.145 9.8e-03
ovarian cancer -2.300 8.2e-07
pancreatic cancer 1.100 9.2e-03
pancreatic carcinoma 1.100 9.2e-03
psoriasis -1.400 1.0e-05

AA Sequence

MFPVLEPHQVGLIRSYNSKTMTCFQELVTFRDVAIDFSRQEWEYLDPNQRDLYRDVMLENYRNLVSLGGH      1 - 70
SISKPVVVDLLERGKEPWMILREETQFTDLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKKCQ     71 - 140
KKFSSGYQLILHHRFHVIERPYECKECGKNFRSGYQLTLHQRFHTGEKPYECTECGKNFRSGYQLTVHQR    141 - 210
FHTGEKTYECRQCGKAFIYASHIVQHERIHTGGKPYECQECGRAFSQGGHLRIHQRVHTGEKPYKCKECG    211 - 280
KTFSRRSNLVEHGQFHTDEKPYICEKCGKAFRRGHQLTVHQRVHTGKKPYECKECGKGYTTASYFLLHQR    281 - 350
IHKGGKPYECKECKKTFTLYRNLTRHQNIHTGEKLFECKQCGKTYTTGSKLFQHQKTHTGEKPYECKECG    351 - 420
KAFSLYGYLKQHQKIHTGMKHFECKECKKTFTLYRNLTRHQNIHTGKKLFECQECGKAYSTGSNLIQHRK    421 - 490
THTGEKPYKCKECGKTFSLHGYLNQHQKIHTGMKPYECKVCRKTFTFYRNLTLHQSIHTDEKPFECKECG    491 - 560
KTFRRSSHLTAHQSIHADKKPYECKECGKAFKMYGYLTQHQKIHTGGKPYECKECGKAFSRASNLVQHER    561 - 630
IHTGEKPYVCKQCGKTFRYGSALKAHQRIHRSIKV                                       631 - 665
//

Text Mined References (6)

PMID Year Title