Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.92
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (2)

PMID Text
23324576 TMEM25 hypermethylation might play a significant role in altering expression of this gene in colorectal cancer.
19776672 TMEM25 may be a useful tumor marker for favorable prognosis in breast cancer.

AA Sequence

MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQ      1 - 70
LQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQ     71 - 140
EAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVA    141 - 210
TNDVGVTSASLPAPGLLATRVEVPLLGIVVAAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSD    211 - 280
SNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVL    281 - 350
GYIYRVSSVSSDEIWL                                                          351 - 366
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23324576 2013 TMEM25 is a candidate biomarker methylated and down-regulated in colorectal cancer.
19776672 2009 TMEM25, REPS2 and Meis 1: favourable prognostic and predictive biomarkers for breast cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15254712 2004 Identification and characterization of human TMEM25 and mouse Tmem25 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...