Property Summary

NCBI Gene PubMed Count 22
PubMed Score 230.33
PubTator Score 159.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 5.0e-07
osteosarcoma 7950 4.2e-04
lung cancer 4740 1.3e-02
astrocytoma 1146 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 3.0
Disease Target Count Z-score Confidence
Prostate cancer 175 3.275 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.200 3.7e-02
lung cancer 1.300 1.3e-02
osteosarcoma -1.638 4.2e-04
ovarian cancer -1.200 5.0e-07

Gene RIF (17)

AA Sequence

MVRPRRAPYRSGAGGPLGGRGRPPRPLVVRAVRSRSWPASPRGPQPPRIRARSAPPMEGARVFGALGPIG      1 - 70
PSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKL     71 - 140
IMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSK    141 - 210
KKIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRW    211 - 280
LPSHVYVNQGEILRTEQWPRKLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGC    281 - 350
VHFSYKASCEIRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG        351 - 416
//

Text Mined References (28)

PMID Year Title