Property Summary

NCBI Gene PubMed Count 18
Grant Count 36
R01 Count 22
Funding $4,572,531.11
PubMed Score 215.60
PubTator Score 159.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.638 0.000
astrocytoma 1.200 0.037
lung cancer 1.300 0.013
ovarian cancer 2.000 0.000

Gene RIF (13)

PMID Text
26746655 High PTOV1 expression was associated with invasive urothelial carcinoma.
26305455 PTOV1 overexpression is associated with poor survival outcomes of nasopharyngeal carcinoma patients.
25634174 Our study demonstrated that PTOV1 overexpression is correlated with increased aggressiveness of hepatocellular carcinoma and could be a prognostic biomarker for patients with HCC
25270739 PTOV1 protein abnormal expression might contribute to the malignant progression of epithelial ovarian cancer.
24947166 The study showed that PTOV1 is upregulated in breast cancer cell lines and clinical samples, and its expression was positively associated with progression and aggressiveness of breast cancer, suggesting that PTOV1 could serve as an independent prognostic marker.
24684754 In prostate tumors, the overexpression of PTOV1 was associated with decreased expression of HEY1 and HES1, and this correlation was significant in metastatic lesions.
23321499 RA-induced cancer cell cytotoxicity was significantly impaired by Zyxin or PTOV1. Overall, our findings suggest that Zyxin and PTOV1 should be considered as critical determinants in cancer therapy with retinoids
22507319 alpha-Methyl-CoA racemase can be considered a more accurate marker than PTOV1 in the identification of high-grade prostatic intraepithelial neoplasia (HGPIN) and of prostate cancer.
21181414 PTOV1 expression is associated to more aggressive human carcinomas and more significantly to bladder carcinomas suggesting that this protein is a potential new marker of aggressive disease in the latter tumors.
21110951 MED25 and PTOV1 differentially modulate retinoic acid sensitivity in cancer cells depending on their expression levels.
More...

AA Sequence

MVRPRRAPYRSGAGGPLGGRGRPPRPLVVRAVRSRSWPASPRGPQPPRIRARSAPPMEGARVFGALGPIG      1 - 70
PSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKL     71 - 140
IMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSK    141 - 210
KKIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRW    211 - 280
LPSHVYVNQGEILRTEQWPRKLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGC    281 - 350
VHFSYKASCEIRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG        351 - 416
//

Text Mined References (24)

PMID Year Title
26746655 2016 Prostate tumor overexpressed 1 expression in invasive urothelial carcinoma.
26305455 2015 Prostate Tumor Overexpressed 1 (PTOV1) Is a Novel Prognostic Marker for Nasopharyngeal Carcinoma Progression and Poor Survival Outcomes.
25634174 2015 Prostate tumor overexpressed 1 is a novel prognostic marker for hepatocellular carcinoma progression and overall patient survival.
25270739 2015 Increased PTOV1 expression is related to poor prognosis in epithelial ovarian cancer.
24947166 2014 Overexpression of prostate tumor overexpressed 1 correlates with tumor progression and predicts poor prognosis in breast cancer.
24684754 2014 Prostate tumor OVerexpressed-1 (PTOV1) down-regulates HES1 and HEY1 notch targets genes and promotes prostate cancer progression.
23321499 2013 Zyxin cooperates with PTOV1 to confer retinoic acid resistance by repressing RAR activity.
22507319 Is there a role for prostate tumour overexpressed-1 in the diagnosis of HGPIN and of prostatic adenocarcinoma? A comparison with alpha-methylacyl CoA racemase.
21181414 2011 PTOV1 is overexpressed in human high-grade malignant tumors.
21110951 2011 PTOV1 antagonizes MED25 in RAR transcriptional activation.
More...