Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.02
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 3 months 1.500 0.000
non-small cell lung cancer -1.113 0.000
interstitial cystitis 1.100 0.008
spina bifida 1.226 0.044

Synonym

Accession Q86YC3
Symbols GARPL1
LRRC33
UNQ3030
ELLP3030

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
24550525 results suggest that LRRC33 and TLRs may form a negative-feedback loop, which is important for the maintenance of immune homeostasis.
23545260 LRRC33 represents the first identified LRR-containing protein that plays a critical role in desensitizing Toll-like receptor (TLR)-mediated innate immune responses.

AA Sequence

MELLPLWLCLGFHFLTVGWRNRSGTATAASQGVCKLVGGAADCRGQSLASVPSSLPPHARMLTLDANPLK      1 - 70
TLWNHSLQPYPLLESLSLHSCHLERISRGAFQEQGHLRSLVLGDNCLSENYEETAAALHALPGLRRLDLS     71 - 140
GNALTEDMAALMLQNLSSLRSVSLAGNTIMRLDDSVFEGLERLRELDLQRNYIFEIEGGAFDGLAELRHL    141 - 210
NLAFNNLPCIVDFGLTRLRVLNVSYNVLEWFLATGGEAAFELETLDLSHNQLLFFPLLPQYSKLRTLLLR    211 - 280
DNNMGFYRDLYNTSSPREMVAQFLLVDGNVTNITTVSLWEEFSSSDLADLRFLDMSQNQFQYLPDGFLRK    281 - 350
MPSLSHLNLHQNCLMTLHIREHEPPGALTELDLSHNQLSELHLAPGLASCLGSLRLFNLSSNQLLGVPPG    351 - 420
LFANARNITTLDMSHNQISLCPLPAASDRVGPPSCVDFRNMASLRSLSLEGCGLGALPDCPFQGTSLTYL    421 - 490
DLSSNWGVLNGSLAPLQDVAPMLQVLSLRNMGLHSSFMALDFSGFGNLRDLDLSGNCLTTFPRFGGSLAL    491 - 560
ETLDLRRNSLTALPQKAVSEQLSRGLRTIYLSQNPYDCCGVDGWGALQHGQTVADWAMVTCNLSSKIIRV    561 - 630
TELPGGVPRDCKWERLDLGLLYLVLILPSCLTLLVACTVIVLTFKKPLLQVIKSRCHWSSVY            631 - 692
//

Text Mined References (5)

PMID Year Title
24550525 2014 Epigenetically modulated LRRC33 acts as a negative physiological regulator for multiple Toll-like receptors.
23545260 2013 Identification and characterization of a unique leucine-rich repeat protein (LRRC33) that inhibits Toll-like receptor-mediated NF-?B activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.