Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.62
PubTator Score 7.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.428 7.0e-03
adult high grade glioma -1.600 1.6e-04
atypical teratoid / rhabdoid tumor -1.600 1.1e-05
Breast cancer -1.300 4.7e-03
gastric carcinoma -2.600 1.1e-02
glioblastoma -1.700 1.8e-04
intraductal papillary-mucinous adenoma (... -2.600 8.0e-04
intraductal papillary-mucinous carcinoma... -3.600 1.2e-06
intraductal papillary-mucinous neoplasm ... -4.300 2.8e-05
invasive ductal carcinoma 1.100 3.5e-03
lung carcinoma 2.100 1.8e-27
medulloblastoma -1.300 4.2e-03
medulloblastoma, large-cell -1.500 1.1e-03
nasopharyngeal carcinoma 1.300 1.2e-02
osteosarcoma -3.167 1.4e-07
ovarian cancer -1.800 1.2e-10
pancreatic cancer -2.000 1.9e-04
pancreatic ductal adenocarcinoma liver m... -1.712 1.5e-03
Pick disease -1.100 2.9e-06

Gene RIF (12)

AA Sequence

MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSIDNFNTYKIFPKIKKLQERDYF      1 - 70
RYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKMANNTKELEDCEQANKLGAIN     71 - 140
STLSNQSKEAFIDWARYDDSRDHFCELDDERSPAAQYVDLLLNPERYTGYKGTSAWRVWNSIYEENCFKP    141 - 210
RSVYRPLNPLAPSRGEDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNI    211 - 280
KEFKHRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDT    281 - 350
KSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI    351 - 420
QKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRDLQNFKVLLQHSR                           421 - 467
//

Text Mined References (23)

PMID Year Title