Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.42
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 3.42751707108545E-16
malignant mesothelioma 3163 4.50749532198711E-8
Breast cancer 3099 1.20655806081058E-7
lung cancer 4473 8.79140704420493E-4
interstitial cystitis 2299 0.00172746500484191
group 3 medulloblastoma 2254 0.0019601767324711
ductal carcinoma in situ 1745 0.00268541484851765
primitive neuroectodermal tumor 3031 0.0067390182528183
interstitial lung disease 292 0.00711614317104151
osteosarcoma 7933 0.0245130832469914
ependymoma 2514 0.0346516288979754

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.400 0.007
malignant mesothelioma -3.200 0.000
ependymoma 1.800 0.035
osteosarcoma -1.528 0.025
primitive neuroectodermal tumor -1.100 0.007
lung cancer -2.400 0.001
interstitial cystitis -1.200 0.002
group 3 medulloblastoma -1.400 0.002
Breast cancer -1.700 0.000
ductal carcinoma in situ -1.100 0.003
ovarian cancer -2.600 0.000

Synonym

Accession Q86YB7 D3DQ36 Q9NV38
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

AA Sequence

MLRVLCLLRPWRPLRARGCASDGAAGGSEIQVRALAGPDQGITEILMNRPSARNALGNVFVSELLETLAQ      1 - 70
LREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEAEVGVFVQRLRGLMNDIAAFPAPTIAAMDGFALGGG     71 - 140
LELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHA    141 - 210
VAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAA    211 - 280
FREKRTPKFVGK                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.