Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.42
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.400 0.007
malignant mesothelioma -3.200 0.000
ependymoma 1.800 0.035
osteosarcoma -1.528 0.025
primitive neuroectodermal tumor -1.100 0.007
lung cancer -2.400 0.001
interstitial cystitis -1.200 0.002
group 3 medulloblastoma -1.400 0.002
Breast cancer -1.700 0.000
ductal carcinoma in situ -1.100 0.003
ovarian cancer -2.600 0.000

AA Sequence

MLRVLCLLRPWRPLRARGCASDGAAGGSEIQVRALAGPDQGITEILMNRPSARNALGNVFVSELLETLAQ      1 - 70
LREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEAEVGVFVQRLRGLMNDIAAFPAPTIAAMDGFALGGG     71 - 140
LELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHA    141 - 210
VAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAA    211 - 280
FREKRTPKFVGK                                                              281 - 292
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.