Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.42
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer -1.300 2.3e-06
ductal carcinoma in situ -1.100 2.7e-03
ependymoma 1.800 3.5e-02
group 3 medulloblastoma -1.400 2.0e-03
interstitial cystitis -1.200 1.7e-03
interstitial lung disease 1.400 7.1e-03
lung cancer -2.400 8.8e-04
malignant mesothelioma -3.200 4.5e-08
osteosarcoma -1.528 2.5e-02
ovarian cancer -2.200 1.3e-09
primitive neuroectodermal tumor -1.100 6.7e-03

AA Sequence

MLRVLCLLRPWRPLRARGCASDGAAGGSEIQVRALAGPDQGITEILMNRPSARNALGNVFVSELLETLAQ      1 - 70
LREDRQVRVLLFRSGVKGVFCAGADLKEREQMSEAEVGVFVQRLRGLMNDIAAFPAPTIAAMDGFALGGG     71 - 140
LELALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHA    141 - 210
VAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAA    211 - 280
FREKRTPKFVGK                                                              281 - 292
//

Text Mined References (7)

PMID Year Title