Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.06
PubTator Score 9.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Mastitis 48 3.662 1.8

Expression

Gene RIF (11)

AA Sequence

MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRDLEAAYRALTL      1 - 70
GGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVG     71 - 140
CIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAACVKVLRDIEPG    141 - 210
DEVTCFYGEGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGL    211 - 280
LGPRACVHPSPLRRDPFCAACQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHH    281 - 350
AARVSLHRWGGCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA    351 - 420
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL                                421 - 462
//

Text Mined References (21)

PMID Year Title