Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 4
Funding $434,571.66
PubMed Score 0.06
PubTator Score 9.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mastitis 48 3.67 1.8

Expression

Synonym

Accession Q86Y97 Q8WZ10 Q9BRZ6
Symbols SUV420H2
Suv4-20h2

Gene

PDB

3RQ4  

Gene RIF (7)

PMID Text
25814362 One of the most downregulated genes in response to SUV420H2 expression was the Src substrate, tensin-3, a focal adhesion protein that contributes to cancer cell migration.
24396869 The crystal structure of SUV420H2 was used to characterize substrate selectivity and product specificity.
21321083 data indicate that H4K20me3 invokes gene repression by antagonizing hMOF-mediated H4K16Ac
21206904 SUV420H1 and SUV420H2 isoforms have different in their cellular localization and effects on myogenic differentiation
18296440 The data indicate that Suv4-20 generates nearly ubiquitous dimethylation that facilitates the DNA damage response and selective trimethylation that is involved in heterochromatin formation.[Suv4-20]
17672918 occurrence of an unusual TG 3' splice site in intron 5
16322686 The decrease in trimethylation of lysine 20 of histone H4 in breast cancer cells was accompanied by diminished expression of Suv4-20h2 histone methyltransferase.

AA Sequence

MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRDLEAAYRALTL      1 - 70
GGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVG     71 - 140
CIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAACVKVLRDIEPG    141 - 210
DEVTCFYGEGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGL    211 - 280
LGPRACVHPSPLRRDPFCAACQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHH    281 - 350
AARVSLHRWGGCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA    351 - 420
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL                                421 - 462
//

Text Mined References (16)

PMID Year Title
25814362 2015 SUV420H2 suppresses breast cancer cell invasion through down regulation of the SH2 domain-containing focal adhesion protein tensin-3.
24396869 2013 Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
21321083 2011 SUV420H2-mediated H4K20 trimethylation enforces RNA polymerase II promoter-proximal pausing by blocking hMOF-dependent H4K16 acetylation.
21206904 2010 Comparative analyses of SUV420H1 isoforms and SUV420H2 reveal differences in their cellular localization and effects on myogenic differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19486527 2009 The histone methyltransferase SUV420H2 and Heterochromatin Proteins HP1 interact but show different dynamic behaviours.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
18296440 2008 Preferential dimethylation of histone H4 lysine 20 by Suv4-20.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
More...