Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.23
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.600 1.0e-03
Astrocytoma, Pilocytic 1.700 3.2e-07
Atopic dermatitis 2.100 1.2e-05
atypical teratoid / rhabdoid tumor 1.200 2.3e-03
Breast cancer 2.100 4.2e-17
colon cancer 1.800 1.2e-02
Endometriosis 1.594 2.1e-02
glioblastoma 2.200 3.5e-09
group 3 medulloblastoma 3.700 4.6e-08
intraductal papillary-mucinous carcinoma... 1.100 2.7e-03
invasive ductal carcinoma 1.600 5.4e-03
lung adenocarcinoma 1.500 9.2e-08
lung cancer 3.900 3.9e-06
malignant mesothelioma 1.500 7.2e-07
medulloblastoma, large-cell 2.000 4.7e-04
nasopharyngeal carcinoma 1.200 4.7e-05
non-small cell lung cancer 1.727 1.5e-23
osteosarcoma -2.858 9.6e-04
ovarian cancer 1.400 2.4e-04
posterior fossa group A ependymoma 1.300 5.1e-04
primitive neuroectodermal tumor 2.100 5.9e-04
psoriasis 1.100 3.6e-36

Gene RIF (5)

AA Sequence

MSHPGVTTVMAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGP      1 - 70
KKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTMLGREGDPGIMYL     71 - 140
TTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGPLAIREDPDKGVVVQGLSFHQPASAEQLLE    141 - 210
ILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQAVQVAKMSLIDLAGSERASSTHAKGERL    211 - 280
REGANINRSLLALINVLNALADAKGRKTHVPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNT    281 - 350
LKYADRAKEIRLSLKSNVTSLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPPQDLPGSPKSGPPP    351 - 420
EHLPSSPLPPHPPSQPCTPELPAGPRALQEESLGMEAQVERAMEGNSSDQEQSPEDEDEGPAEEVPTQMP    421 - 490
EQNPTHALPESPRLTLQPKPVVGHFSARELDGDRSKQLALKVLCVAQRQYSLLQAANLLTPDMITEFETL    491 - 560
QQLVQEEKIEPGAEALRTSGLARGAPLAQELCSESKPPGYTGPVTRTMARRLSGPLHTLGIPPGPNCTPA    561 - 630
QGSRWPMEKKRRRPSALEADSPMAPKRGTKRQRQSFLPCLRRGSLPDTQPSQGPSTPKGERASSPCHSPR    631 - 700
VCPATVIKSRVPLGPSAMQNCSTPLALPTRDLNATFDLSEEPPSKPSFHECIGWDKIPQELSRLDQPFIP    701 - 770
RAPVPLFTMKGPKPTSSLPGTSACKKKRVASSSVSHGRSRIARLPSSTLKRPAGPLVLPELPLSPLCPSN    771 - 840
RRNGKDLIRVGRALSAGNGVTKVS                                                  841 - 864
//

Text Mined References (18)

PMID Year Title