Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $282,052.25
PubMed Score 4.73
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Gene RIF (5)

PMID Text
26150501 Kif18B is only modestly processive and that the motor switches frequently between directed and diffusive modes of motility.
25236463 High KIF18B expression is associated with neoplasms.
21820309 Results uncover a novel role for Aurora A/B kinases in regulating spindle MT dynamics through Kif18b-MCAK and suggest that the Kif18b-MCAK complex constitutes the major MT plus-end depolymerizing activity in mitotic cells.
21737685 Kif18B is a new microtubule dynamics regulatory protein that interacts with EB1 to control astral microtubule length
20600703 the expression of KIF18B is regulated in a cell cycle-dependent manner and therefore may play an important role(s) in cell division.

AA Sequence

MSHPGVTTVMAVEDSTLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVFNPEEPDGGFPGLKWGGTHDGP      1 - 70
KKKGKDLTFVFDRVFGEAATQQDVFQHTTHSVLDSFLQGYNCSVFAYGATGAGKTHTMLGREGDPGIMYL     71 - 140
TTVELYRRLEARQQEKHFEVLISYQEVYNEQIHDLLEPKGPLAIREDPDKGVVVQGLSFHQPASAEQLLE    141 - 210
ILTRGNRNRTQHPTDANATSSRSHAIFQIFVKQQDRVPGLTQAVQVAKMSLIDLAGSERASSTHAKGERL    211 - 280
REGANINRSLLALINVLNALADAKGRKTHVPYRDSKLTRLLKDSLGGNCRTVMIAAISPSSLTYEDTYNT    281 - 350
LKYADRAKEIRLSLKSNVTSLDCHISQYATICQQLQAEVAALRKKLQVYEGGGQPPPQDLPGSPKSGPPP    351 - 420
EHLPSSPLPPHPPSQPCTPELPAGPRALQEESLGMEAQVERAMEGNSSDQEQSPEDEDEGPAEEVPTQMP    421 - 490
EQNPTHALPESPRLTLQPKPVVGHFSARELDGDRSKQLALKVLCVAQRQYSLLQAANLLTPDMITEFETL    491 - 560
QQLVQEEKIEPGAEALRTSGLARGAPLAQELCSESKPPGYTGPVTRTMARRLSGPLHTLGIPPGPNCTPA    561 - 630
QGSRWPMEKKRRRPSALEADSPMAPKRGTKRQRQSFLPCLRRGSLPDTQPSQGPSTPKGERASSPCHSPR    631 - 700
VCPATVIKSRVPLGPSAMQNCSTPLALPTRDLNATFDLSEEPPSKPSFHECIGWDKIPQELSRLDQPFIP    701 - 770
RAPVPLFTMKGPKPTSSLPGTSACKKKRVASSSVSHGRSRIARLPSSTLKRPAGPLVLPELPLSPLCPSN    771 - 840
RRNGKDLIRVGRALSAGNGVTKVS                                                  841 - 864
//

Publication (16)

PMID Year Title
26150501 2015 Biased Brownian motion as a mechanism to facilitate nanometer-scale exploration of the microtubule plus end by a kinesin-8.
25236463 2015 Translating bioinformatics in oncology: guilt-by-profiling analysis and identification of KIF18B and CDCA3 as novel driver genes in carcinogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21820309 2011 A complex of Kif18b and MCAK promotes microtubule depolymerization and is negatively regulated by Aurora kinases.
21737685 2011 Kif18B interacts with EB1 and controls astral microtubule length during mitosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20600703 2010 Cell cycle-regulated expression and subcellular localization of a kinesin-8 member human KIF18B.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...