Property Summary

NCBI Gene PubMed Count 10
Grant Count 85
R01 Count 46
Funding $5,484,583.08
PubMed Score 1.00
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000

Synonym

Accession Q86Y79 PTH
Symbols PTH1
C9orf115

Gene

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
14660562 arrangement of secondary structure elements generates a fold not previously reported for peptidyl-trna hydrolase and intermolecular contacts in the crystal asymmetric unit cell suggest a likely surface for protein-protein interactions

AA Sequence

MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDR      1 - 70
HCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARG     71 - 140
HNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGP    141 - 210
SLGP                                                                      211 - 214
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660562 2004 Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.