Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.87
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.107 9.6e-03
Astrocytoma, Pilocytic -1.600 4.0e-07
Breast cancer -1.700 9.4e-05
cystic fibrosis 1.258 2.6e-04
group 3 medulloblastoma -1.400 5.6e-03
interstitial cystitis -1.500 5.9e-03
intraductal papillary-mucinous adenoma (... 1.100 2.1e-02
oligodendroglioma -1.100 1.7e-02
pituitary cancer 2.000 2.5e-04

Gene RIF (4)

AA Sequence

MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYC      1 - 70
PRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATF     71 - 140
ATTSPINQTNGHPRCMSVIVSCLWLWLGLML                                           141 - 171
//

Text Mined References (12)

PMID Year Title