Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
R01 Count 1
Funding $84,250.8
PubMed Score 3.94
PubTator Score 1.99

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
oligodendroglioma -1.100 0.017
cystic fibrosis 2.050 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.021
active Crohn's disease 1.107 0.010
interstitial cystitis -2.100 0.000
group 3 medulloblastoma -1.500 0.003
pilocytic astrocytoma -1.600 0.000
Breast cancer -1.700 0.000
pituitary cancer 3.500 0.000

Gene RIF (3)

23987510 Lypd6 appears to control Lrp6 activation specifically in membrane rafts, which is essential for downstream signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19653121 The cloning and characterization of a novel human LU domain containing gene, LYPD6, isolated from human testis cDNA library, is reported.

AA Sequence

ATTSPINQTNGHPRCMSVIVSCLWLWLGLML                                           141 - 171

Text Mined References (11)

PMID Year Title
23987510 2013 Lypd6 enhances Wnt/?-catenin signaling by promoting Lrp6 phosphorylation in raft plasma membrane domains.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19653121 2010 Identification and characterization of human LYPD6, a new member of the Ly-6 superfamily.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.