Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.36
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.200 5.3e-05
astrocytoma 1.600 7.3e-03
atypical teratoid / rhabdoid tumor 1.800 3.7e-07
ependymoma 1.200 3.0e-02
glioblastoma 1.400 1.8e-07
group 3 medulloblastoma 1.300 1.1e-02
intraductal papillary-mucinous carcinoma... 1.400 5.9e-04
intraductal papillary-mucinous neoplasm ... 1.300 6.5e-03
lung cancer 1.100 2.4e-02
malignant mesothelioma 1.800 9.7e-08
medulloblastoma, large-cell 2.000 2.2e-04
ovarian cancer 1.200 4.8e-04
primitive neuroectodermal tumor 1.300 1.2e-03

Gene RIF (1)

AA Sequence

MAALGVAEAVAAPHPAEGAETAEAVELSRALSRLLPGLEADSKPGRRRALEALRRALEEPGPAADPTAFQ      1 - 70
GPWARLLLPRLLRCLSDPAEGCRALAVHLLDLGLRRAARPRDALPRLLPALAARLAGPVPARRPPEACEE     71 - 140
LRLALVQLLGLAVDLCGAALAPHLDDALRALRCSLLDPFAAVRRESCSCAAALAQATPDHFHMQSESLIG    141 - 210
PLMQTISHQHWKVRVAAIEATGAVIHFGNGKSVDDVLSHFAQRLFDDVPQVRRAVASVVGGWLLCLRDRY    211 - 280
SFFHKLIPLLLSSLNDEVPEVRQLAASLWEDVGLQWQKENEEDLKDKLDFAPPTPPHYPPHERRPVLGCR    281 - 350
ELVFRNLSKILPALCHDITDWVVGTRVKSAQLLPVLLLHAEDHATQHLEVVLRTLFQACTDEEAAVVQSC    351 - 420
TRSAELVGTFVSPEVFLKLILSTLKKTPSASGLLVLASAMRGCPREALQPHLAAIATELAQAHICQASEN    421 - 490
DLYLERLLLCVQALVSVCHEDCGVASLQLLDVLLTIVALAGATGLRDKAQETMDSLAMVEGVSSCQDLYR    491 - 560
KHIGPLLERVTASHLDWTAHSPELLQFSVIVAQSGPALGEALPHVVPTLRACLQPSQDPQMRLKLFSILS    561 - 630
TVLLRATDTINSQGQFPSYLETVTKDILAPNLQWHAGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQE    631 - 700
TLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIRIYPELLKRLDDVSNDVRMAAASTLVTW    701 - 770
LQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAILEVLKEGSGLFPDLLVRETEAVIHKHRSATY    771 - 840
CEQLLQHVQAVPATQ                                                           841 - 855
//

Text Mined References (15)

PMID Year Title