Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.40
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Creutzfeldt-Jakob Syndrome 10 0.0 0.0
Disease Target Count
Creutzfeldt-Jakob disease 21
Disease Target Count P-value
ovarian cancer 8520 4.2e-11
psoriasis 6694 6.4e-11
adult high grade glioma 3801 3.8e-05
medulloblastoma, large-cell 6241 6.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma 1.200 3.8e-05
medulloblastoma, large-cell 1.300 6.9e-05
ovarian cancer 1.500 4.2e-11
psoriasis -1.100 6.4e-11

Gene RIF (1)

AA Sequence

MSRQFTYKSGAAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSSRSLYSLGGARSISFNVASGSGWAGG      1 - 70
YGFGRGRASGFAGSMFGSVALGSVCPSLCPPGGIHQVTINKSLLAPLNVELDPEIQKVRAQEREQIKVLN     71 - 140
NKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPILEGYISNLRKQLETLSGDRVRLDSELRS    141 - 210
VREVVEDYKKRYEEEINKRTTAENEFVVLKKDVDAAYTSKVELQAKVDALDGEIKFFKCLYEGETAQIQS    211 - 280
HISDTSIILSMDNNRNLDLDSIIAEVRAQYEEIARKSKAEAEALYQTKFQELQLAAGRHGDDLKHTKNEI    281 - 350
SELTRLIQRLRSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEGALQQAKEELARMLREYQEL    351 - 420
LSVKLSLDIEIATYRKLLEGEECRMSGEYTNSVSISVINSSMAGMAGTGAGFGFSNAGTYGYWPSSVSGG    421 - 490
YSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR                        491 - 540
//

Text Mined References (11)

PMID Year Title