Property Summary

Ligand Count 1
NCBI Gene PubMed Count 8
PubMed Score 3.79
PubTator Score 3.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 2.0e-05

Gene RIF (1)

AA Sequence

MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVF      1 - 70
GLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPK     71 - 140
V//

Text Mined References (12)

PMID Year Title