Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.55
PubTator Score 3.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 0.000

Synonym

Accession Q86Y39 C9JT23 Q6ZS66
Symbols B14.7
CI-B14.7

Gene

Gene RIF (1)

PMID Text
18306244 study identified a splice-site mutation in the NDUFA11 gene in six mitochondrial complex I deficiency patients from three unrelated families

AA Sequence

MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVF      1 - 70
GLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPK     71 - 140
V//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
18306244 2008 Mitochondrial complex I deficiency caused by a deleterious NDUFA11 mutation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12951057 2003 cDNA microarray analysis of altered gene expression in Ara-C-treated leukemia cells.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...